Recombinant Dictyostelium discoideum Metabotropic glutamate receptor-like protein F (grlF)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

GrlF belongs to the Family 3 GPCRs, which include metabotropic glutamate and GABA<sub>B</sub> receptors . In Dictyostelium discoideum, 17 genes encode Grl proteins, with GrlF classified under UniProt ID Q54SW3. The recombinant form spans residues 23–770 of the mature protein, fused with an N-terminal His tag for purification .

PropertyDetails
Gene NamegrlF (DDB_G0282175)
Protein Length748 amino acids (23–770)
Expression HostEscherichia coli
TagN-terminal His tag
Purity≥ 85–90% (SDS-PAGE verified)

Sequence Highlights

  • N-terminal extracellular domain: Mediates ligand recognition.

  • C-terminal intracellular domain: Facilitates downstream signaling .

Expression and Purification

The recombinant protein is produced in E. coli systems, lyophilized in Tris/PBS buffer with 6% trehalose (pH 8.0) . Reconstitution recommendations include:

  • Solubility: Use sterile deionized water at 0.1–1.0 mg/mL.

  • Storage: Aliquot with 50% glycerol for long-term stability at -80°C .

Research Applications

GrlF is utilized in:

  1. GPCR Signaling Studies: Investigating ligand-receptor interactions in non-animal models.

  2. Protein-Protein Interaction Screens: Identifying binding partners via pull-down assays .

  3. Antibody Production: Serving as an antigen for polyclonal antibody development .

Limitations and Future Directions

  • Functional Data Gap: No direct studies confirm GrlF’s ligands or downstream effectors.

  • Structural Studies: Cryo-EM or X-ray crystallography could resolve activation mechanisms.

  • Comparative Analyses: Contrast GrlF with GrlD/GrlB to delineate functional divergence .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested. Please contact us in advance for dry ice shipping; additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1–1.0 mg/mL. For long-term storage, we recommend adding 5–50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us, and we will prioritize its implementation.
Synonyms
grlF; DDB_G0282175; Metabotropic glutamate receptor-like protein F
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-770
Protein Length
Full Length of Mature Protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
grlF
Target Protein Sequence
QNKTCKISVLLSGDKSDLGYNYMMNEARVLAESQLHMYPFSIYYEHLEESTLEAEHAIQD SVDKGANLIVVSSVIHFSLGVKYATKYKDEPIYWIIRGSKLVPTLPKVVILNFNSFELHY LLGYYAGLATKTGVVGFVSPGIGINTLSCDNSFYIGAKYARSNITFLDIHTGSWYNPEVS YKAAQKLIENGADVIGMSQDDMSVQKAIMDSGGLGLGVTGYPGHYQFGSDVAYSYLTNWT NLFITYANHVINDDWPAFDSFFTNLSRKDAIFMDDFSFRVPIDIQTKTKIELENLMNTSY APYKSDPILESIGLQFSGNWINDTQFRANTKILPSYGDSTVDYPESLKIGVTVVSGFCIF LCLISMIIVIKFKEAKVIKSSSPIFCLLILFGCIVIFVGCIMFARSPTDGSCRSRVWLLS LGYTIFLGNLMVKNWRIWLLFDNPKLKKRAITNWKLYPWVSGIVIIDIVILSIWQALGDI VAESRTGIDSLTKYEYRNVCASSDQGSIALYLLLVFHGLILLVACFISFKIKVVDIEEFN ESKPITTSVYIITFCLFIVIPIMVSSPTVTTQTTIICICALITTMLSIILLFGTKFFKMI TVGLELGQTFVTSTKSSSHSQRTKSSKSSNGSGPKINGFGGNVLNLDDDSDEISSEKEKK KPIESNPKDHMAVFTSDEETSKASKFSSEQFSREQINDNIILENNNDNEEKQKDEEEIKE EKLLVSEIQAKRLSLEQNGQTEIDSNDV
Uniprot No.

Target Background

Database Links
Protein Families
BMP lipoprotein family; G-protein coupled receptor 3 family, GABA-B receptor subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Dictyostelium discoideum Metabotropic Glutamate Receptor-Like Protein F (grlF)?

Dictyostelium discoideum grlF is a metabotropic glutamate receptor-like protein consisting of 770 amino acids. The mature protein (residues 23-770) contains several key structural features typical of G protein-coupled receptors. The full amino acid sequence includes multiple transmembrane domains that form a characteristic seven-transmembrane structure, with intracellular and extracellular regions that participate in signaling . The protein contains distinctive domains including ligand-binding regions and intracellular signaling components that enable its function in cellular signaling pathways .

What is the functional role of grlF in Dictyostelium discoideum signaling pathways?

In Dictyostelium discoideum, grlF functions within signaling networks that regulate cellular processes similar to those controlled by small G-proteins in this organism. While specific grlF signaling mechanisms are still being characterized, research on related signaling pathways in Dictyostelium shows that such receptors participate in processes including cytoskeletal regulation, chemotaxis, cell division, and multicellular development . The receptor likely interacts with Dictyostelium G-proteins to initiate downstream signaling cascades that regulate these cellular functions, particularly during the organism's transition between unicellular and multicellular stages of its life cycle .

What expression systems are most effective for producing recombinant grlF protein?

E. coli has been demonstrated as an effective expression system for producing recombinant grlF protein. Current protocols show successful expression of the full-length mature protein (residues 23-770) fused to an N-terminal His-tag in bacterial systems . While E. coli may lack certain post-translational modifications found in eukaryotic systems, it offers advantages of high yield and straightforward purification procedures that make it suitable for structural and biochemical studies. Researchers should consider the following experimental parameters when using E. coli:

ParameterRecommended ConditionNotes
Expression strainBL21(DE3) or similarStrains with reduced protease activity
Induction temperature16-18°CLower temperatures reduce inclusion body formation
IPTG concentration0.1-0.5 mMOptimize based on strain and construct
Expression time16-20 hoursExtended time at lower temperature

Alternative expression systems such as insect cells or yeast might be considered for experiments requiring native post-translational modifications .

What purification strategy yields the highest purity of functional grlF protein?

A multi-step purification strategy is recommended for obtaining high-purity grlF protein. Since the recombinant protein includes an N-terminal His-tag, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin serves as an effective initial capture step . For research requiring >90% purity, the following purification workflow has proven successful:

  • Initial IMAC purification using Ni-NTA resin

  • Buffer exchange to remove imidazole

  • Secondary purification using size exclusion chromatography

  • Final quality assessment via SDS-PAGE and Western blotting

This approach consistently yields protein with greater than 90% purity as determined by SDS-PAGE . For functional studies, researchers should verify protein activity through appropriate binding or signaling assays following purification.

What are the critical considerations for maintaining grlF stability during and after purification?

Maintaining grlF stability requires careful attention to buffer composition, temperature, and handling procedures. Based on established protocols, the following conditions are recommended:

  • Storage buffer: Tris/PBS-based buffer, pH 8.0, containing 6% trehalose as a stabilizing agent

  • Storage temperature: -20°C to -80°C for long-term storage, with working aliquots maintained at 4°C for up to one week

  • Freeze-thaw cycles: Minimize repeated freeze-thaw cycles, as these significantly reduce protein stability and activity

  • Initial handling: Centrifuge lyophilized protein briefly before opening to ensure content settlement

Additionally, researchers should consider adding protease inhibitors during purification and initial handling steps to prevent degradation. The presence of the stabilizing agent trehalose in the storage buffer is particularly important for maintaining protein conformation during freeze-thaw transitions .

How can researchers effectively study grlF interactions with downstream signaling partners?

To study grlF interactions with downstream signaling partners, multiple complementary approaches can be employed:

  • Pull-down assays: Similar to methods used for studying Rap1-GxcC interactions in Dictyostelium, GST-fusion proteins can be used to identify binding partners. For example, researchers can express GST-fused grlF and GFP-tagged potential partners in Dictyostelium and perform pull-down experiments using GSH beads .

  • Co-immunoprecipitation: For validating interactions in cellular contexts, co-immunoprecipitation with antibodies against grlF or epitope tags can identify associated proteins in near-native conditions.

  • Guanine nucleotide dissociation inhibition (GDI) assays: To determine if interactions are direct and nucleotide-dependent (particularly relevant for G-protein interactions), researchers can adapt GDI assays similar to those used for Rap1 studies .

  • Domain mapping: Creating truncated constructs of grlF (similar to the approach used with GxcC) can help identify which domains are responsible for specific protein-protein interactions .

These methodologies should be combined with appropriate controls to validate specificity, such as testing against related but distinct proteins (as demonstrated in the RasC/RasG specificity tests with GxcC) .

What are the most effective methods for studying grlF activation mechanisms?

Studying grlF activation mechanisms requires techniques that can detect conformational changes and downstream signaling events. Recommended approaches include:

  • FRET-based biosensors: Develop fluorescence resonance energy transfer constructs that can report on conformational changes upon activation.

  • GTP-binding assays: If grlF modulates G-protein activity, researchers can measure GTP binding and hydrolysis rates in the presence of potential activators.

  • Live-cell imaging: Using fluorescently-tagged grlF constructs to monitor localization changes during activation, similar to the TIRF microscopy approach used to visualize Rac activation in Dictyostelium .

  • Electrophysiology: For functional characterization, patch-clamp techniques may be adapted to measure channel activities modulated by grlF signaling.

  • Calcium flux measurements: Since mammalian metabotropic glutamate receptors often couple to calcium signaling pathways, calcium imaging might reveal functional activation .

A multi-method approach is recommended, as each technique offers different insights into the activation process.

How does grlF function compare in different developmental stages of Dictyostelium discoideum?

The function of grlF likely varies across Dictyostelium's life cycle, similar to other signaling proteins in this organism. Though specific data on grlF expression patterns across developmental stages is limited, research on related signaling pathways suggests:

  • Vegetative state: During the single-celled amoeba stage when Dictyostelium feeds on bacteria, grlF may participate in nutrient sensing and cytoskeletal regulation for motility and phagocytosis .

  • Starvation response: Upon starvation, Dictyostelium undergoes a tightly regulated developmental program. During this transition, grlF could play a role in cellular communication similar to how Rap1 signaling contributes to chemotactic responses .

  • Multicellular development: As cells aggregate and form multicellular structures, grlF might function in cell-cell communication pathways essential for coordinated morphogenesis.

To study these stage-specific functions, researchers should:

  • Compare grlF expression levels across developmental stages using RT-PCR or Western blotting

  • Create stage-specific knockdowns using inducible RNAi systems

  • Analyze phenotypes of grlF mutants during different developmental transitions

What computational approaches are most useful for predicting grlF binding sites and functional domains?

Computational analysis of grlF structure and function can employ several complementary approaches:

  • Homology modeling: Using solved structures of related metabotropic glutamate receptors as templates, researchers can generate three-dimensional models of grlF to predict structural features.

  • Molecular dynamics simulations: To analyze conformational flexibility and potential binding sites, MD simulations with appropriate force fields can reveal dynamic properties not captured in static models.

  • Sequence-based predictions: Tools that identify conserved domains, transmembrane regions, and post-translational modification sites are valuable for initial characterization. The amino acid sequence provided in the technical data sheet can serve as input for these analyses .

  • Protein-protein interaction predictions: Algorithms that identify potential interaction interfaces based on surface properties and evolutionary conservation can guide experimental designs.

When applying these methods, researchers should consider:

  • The quality of template structures used for modeling

  • The specific domains of interest (e.g., ARM domains, which mediate Rap1 binding in GxcC)

  • Validation of computational predictions through experimental approaches

What are the critical differences between grlF signaling and mammalian metabotropic glutamate receptor signaling?

While both grlF and mammalian metabotropic glutamate receptors function as G protein-coupled receptors, several key differences distinguish their signaling mechanisms:

  • G-protein coupling specificity: Mammalian mGluR5 couples primarily to Gq proteins, activating phospholipase C pathways . In contrast, grlF likely interacts with Dictyostelium-specific G-proteins that have evolved to regulate amoeboid functions.

  • Ligand specificity: While mammalian mGluRs are activated by glutamate, the natural ligand for grlF remains to be conclusively identified. This represents a significant knowledge gap in understanding grlF activation.

  • Downstream effectors: Mammalian mGluRs are involved in neuronal signaling processes including synaptic plasticity and excitability, interacting with neuronal effectors . Conversely, grlF likely regulates cytoskeletal dynamics and cell motility through Dictyostelium-specific effector proteins.

  • Regulatory mechanisms: The regulatory machinery controlling receptor desensitization, internalization, and recycling likely differs substantially between mammalian systems and Dictyostelium.

These differences highlight the evolutionary divergence of G protein-coupled receptor signaling systems while maintaining core structural and mechanistic features.

How can advanced structural biology techniques be applied to understand grlF function?

Several cutting-edge structural biology approaches can provide critical insights into grlF structure and function:

  • Cryo-electron microscopy: For whole-protein structural determination, cryo-EM has emerged as a powerful technique for membrane proteins like GPCRs. Sample preparation should focus on:

    • Detergent selection for membrane protein solubilization

    • Lipid nanodisc reconstitution for near-native environment

    • Conformation stabilization strategies

  • X-ray crystallography: While challenging for full-length membrane proteins, crystallography of isolated domains (particularly extracellular or intracellular regions) can provide high-resolution structural information.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): To map conformational changes upon activation or binding partner interaction, HDX-MS offers advantages of requiring less protein and no crystallization.

  • Site-directed spin labeling with EPR spectroscopy: For analyzing specific structural transitions in response to activation, this approach can measure distances between labeled sites during functional transitions.

  • Cross-linking mass spectrometry: To identify interaction interfaces, chemical cross-linking followed by MS analysis can map proximity relationships between specific residues.

Each method offers complementary information, and researchers should consider combining approaches for comprehensive structural characterization.

What are the common challenges in grlF protein expression and how can they be overcome?

Researchers working with recombinant grlF face several common challenges that can be addressed with specific optimization strategies:

ChallengeOptimization Strategy
Poor expression yield- Optimize codon usage for the expression host
- Test different promoter strengths
- Evaluate expression temperature (lower to 16-18°C)
- Try fusion partners that enhance solubility (e.g., MBP, SUMO)
Protein insolubility- Express as fusion with solubility-enhancing tags
- Modify buffer conditions (pH, salt concentration)
- Add stabilizing agents like glycerol or specific detergents
- Consider refolding from inclusion bodies
Proteolytic degradation- Add protease inhibitors during purification
- Use protease-deficient expression strains
- Optimize purification speed to minimize degradation time
- Identify and modify protease-sensitive sites
Low protein activity- Verify proper folding through circular dichroism
- Ensure critical post-translational modifications
- Test different buffer compositions for activity assays
- Evaluate the impact of storage conditions on activity

For expression in E. coli systems specifically, optimizing induction parameters (IPTG concentration, induction time, culture density at induction) can significantly improve yield and quality of the recombinant protein .

How can researchers validate the functional integrity of purified grlF protein?

Validating the functional integrity of purified grlF is critical before proceeding with detailed studies. Several complementary approaches are recommended:

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure elements

    • Thermal shift assays to evaluate protein stability

    • Size-exclusion chromatography to verify monodispersity and proper oligomeric state

  • Ligand binding assays:

    • Develop fluorescence-based or radioligand binding assays using potential ligands

    • Isothermal titration calorimetry (ITC) to measure binding thermodynamics

    • Surface plasmon resonance (SPR) for binding kinetics analysis

  • G-protein coupling:

    • GTPγS binding assays to measure G-protein activation

    • Bioluminescence resonance energy transfer (BRET) assays for monitoring receptor-G protein interactions

  • Downstream signaling:

    • In vitro reconstitution of signaling components to measure activity

    • Cell-based reporter assays when expressed in appropriate cellular contexts

A multi-parameter validation approach provides the most comprehensive assessment of functional integrity.

What are the key considerations when designing grlF mutation studies for structure-function analysis?

When designing mutation studies for grlF structure-function analysis, researchers should consider:

  • Targeting strategy:

    • Conservative vs. non-conservative substitutions to probe chemical requirements

    • Alanine-scanning mutagenesis of putative functional regions

    • Domain swapping with related receptors to identify functional modules

    • Truncation constructs to map minimal functional units

  • Residue selection rationale:

    • Evolutionary conservation analysis to identify functionally constrained residues

    • Homology to mammalian mGluRs with known structure-function relationships

    • Computational prediction of functionally important sites

    • Known post-translational modification sites

  • Functional readouts:

    • Binding assays to assess ligand interaction

    • G-protein coupling efficiency

    • Downstream signaling activation

    • Protein localization and trafficking

  • Controls and validation:

    • Include wild-type controls processed identically to mutants

    • Verify protein expression levels and stability of mutants

    • Consider rescue experiments in knockout backgrounds

    • Use multiple functional assays to comprehensively characterize each mutant

The amino acid sequence provided in the technical specifications offers a starting point for identifying conserved domains and potential functional motifs for targeted mutagenesis .

How does grlF compare to other G protein-coupled receptors in Dictyostelium discoideum?

Dictyostelium discoideum contains multiple G protein-coupled receptors that serve diverse functions in the organism's life cycle. In comparative analysis, grlF shows several distinctive features:

  • Receptor families: Dictyostelium possesses several GPCR families including cAMP receptors (cARs), GABA receptor-like proteins (GrlA-E), and metabotropic glutamate receptor-like proteins (including grlF). Each family has evolved specific signaling roles within the organism's unique lifestyle .

  • Structural organization: While maintaining the core seven-transmembrane architecture common to GPCRs, grlF exhibits unique extracellular domains that likely reflect its specific ligand recognition requirements. The protein's large extracellular N-terminal domain contains amino acid motifs distinct from other Dictyostelium GPCRs .

  • G-protein coupling specificity: Different Dictyostelium GPCRs couple to specific G-proteins, with some receptors activating multiple G-protein subtypes. The coupling preferences of grlF provide insights into its participation in specific signaling networks analogous to the small G-protein networks documented in Dictyostelium .

  • Developmental expression: GPCRs in Dictyostelium often show stage-specific expression patterns aligned with their functional roles. Understanding where grlF fits within this developmental program provides context for its evolutionary purpose.

What evolutionary insights can be gained from comparing grlF to metabotropic glutamate receptors across species?

Comparative analysis of grlF with metabotropic glutamate receptors across species reveals important evolutionary insights:

  • Ancient origin of glutamate signaling: The presence of glutamate receptor-like proteins in Dictyostelium, which diverged from the animal lineage over 1 billion years ago, suggests that glutamate signaling mechanisms predate the evolution of nervous systems.

  • Functional conservation vs. divergence: While mammalian mGluRs function primarily in neuronal signaling , the presence of structurally related receptors in Dictyostelium indicates that the core signaling architecture was repurposed for different functions across evolutionary time.

  • Ligand binding evolution: The ligand specificity of grlF may differ from mammalian counterparts, reflecting adaptation to different environmental signals. Mammalian mGluRs bind glutamate, while the natural ligand for grlF remains to be conclusively identified.

  • Signaling network complexity: Mammalian mGluRs operate within complex neuronal networks and can be classified into three groups based on sequence homology and signaling mechanisms . The simpler cellular context of Dictyostelium provides an opportunity to understand the foundational aspects of these signaling systems.

  • Structural adaptation: Comparing the amino acid sequence of grlF with mammalian counterparts reveals conserved structural elements alongside Dictyostelium-specific adaptations that reflect its unique cellular environment and signaling requirements.

How do post-translational modifications affect grlF function, and how do these compare with mammalian systems?

Post-translational modifications (PTMs) likely play crucial roles in regulating grlF function, though specific data on grlF modifications is limited. Comparative analysis suggests:

  • Phosphorylation: The grlF sequence contains multiple potential phosphorylation sites, particularly in intracellular loops and the C-terminal domain . In mammalian systems, mGluR phosphorylation regulates desensitization, internalization, and signaling bias. Similar regulatory mechanisms may exist for grlF, though the specific kinases involved likely differ.

  • Glycosylation: The extracellular domains of grlF contain potential N-linked glycosylation sites (N-X-S/T motifs) that may affect ligand binding and receptor trafficking . When expressing recombinant grlF in E. coli, researchers should note that bacterial expression systems lack glycosylation machinery, potentially affecting certain functional properties of the protein.

  • Palmitoylation: Cysteine residues in the C-terminal domain may serve as sites for palmitoylation, which can affect receptor localization and signaling. The specific pattern of palmitoylation may differ between grlF and mammalian mGluRs, reflecting different membrane microenvironment requirements.

  • Ubiquitination: Lysine residues in intracellular domains may be targets for ubiquitination, regulating receptor degradation and recycling pathways. The ubiquitination machinery in Dictyostelium, while similar to mammalian systems, may target different specific residues.

Understanding these modifications is crucial for interpreting functional data, particularly when studying recombinant proteins expressed in systems that may not recapitulate native PTM patterns.

What emerging technologies hold the most promise for advancing grlF research?

Several cutting-edge technologies are poised to significantly advance grlF research:

  • CRISPR-Cas9 genome editing in Dictyostelium: Precise genome editing allows:

    • Creation of endogenous tagged versions of grlF for localization studies

    • Generation of domain-specific mutations to probe function

    • Development of conditional knockout systems for temporal control

  • Single-molecule imaging techniques:

    • Super-resolution microscopy to visualize grlF distribution and dynamics

    • Single-particle tracking to analyze receptor mobility and clustering

    • FRET-based approaches to monitor conformational changes in real-time

  • Proteomic approaches:

    • Proximity labeling techniques (BioID, APEX) to identify interaction partners in native contexts

    • Phosphoproteomics to map signaling networks downstream of grlF

    • Targeted proteomics to quantify PTMs under different conditions

  • Cryo-electron tomography:

    • Direct visualization of grlF in its native membrane environment

    • Structural analysis of signaling complexes at molecular resolution

  • AlphaFold2 and related AI approaches:

    • Improved structural prediction for domains lacking experimental structures

    • Prediction of protein-protein interaction interfaces

    • Design of specific modulators for functional studies

These technologies, when applied to grlF research, promise to resolve current knowledge gaps and provide unprecedented insights into receptor function.

How might comparative studies between grlF and mammalian metabotropic glutamate receptors advance drug discovery?

Comparative studies between grlF and mammalian mGluRs can contribute to drug discovery in several ways:

  • Evolutionary conservation of binding sites: Identifying conserved structural elements between Dictyostelium grlF and mammalian mGluRs can reveal fundamental binding pocket features that might be targeted by novel compounds . Conserved sites often indicate functional importance across evolutionary time.

  • Simplified model systems: Dictyostelium provides a less complex cellular background for studying receptor function, potentially allowing clearer interpretation of compound effects on specific signaling pathways before advancing to more complex mammalian systems.

  • Allosteric modulator development: Understanding how structural differences between grlF and mammalian mGluRs affect ligand binding could inform the development of highly selective allosteric modulators. The mammalian mGluR5 has known allosteric binding sites that have been targets for drug development .

  • Functional domain insights: Domain swapping experiments between grlF and mammalian mGluRs can identify which structural elements determine specific signaling properties, guiding rational drug design targeting these domains.

  • Compound screening platforms: Developing Dictyostelium-based screening systems using grlF could provide complementary approaches to mammalian cell-based assays, potentially identifying compounds with novel mechanisms of action.

What are the most significant unanswered questions in grlF research that would benefit from collaborative investigation?

Several key questions about grlF remain unanswered and would benefit from collaborative research approaches:

  • Natural ligand identification: What is the endogenous ligand for grlF in Dictyostelium? This fundamental question requires integration of:

    • Metabolomic profiling of Dictyostelium extracellular environment

    • Candidate ligand screening using functional assays

    • Structural biology approaches to identify binding pockets

  • Signaling network mapping: How does grlF integrate into broader signaling networks in Dictyostelium? This question demands:

    • Phosphoproteomic analysis in wild-type and grlF mutant backgrounds

    • Genetic interaction screens to identify functional relationships

    • Temporal analysis of signaling during development

  • Structural dynamics during activation: What conformational changes occur during grlF activation? This requires:

    • Advanced structural biology techniques (cryo-EM, HDX-MS)

    • Computational modeling and molecular dynamics simulations

    • Site-specific spectroscopic approaches to track conformational changes

  • Evolutionary relationship to mammalian systems: How did metabotropic glutamate receptor signaling evolve from ancient origins to specialized neural functions? This question necessitates:

    • Comprehensive phylogenetic analysis across diverse organisms

    • Functional characterization of receptors from evolutionary intermediates

    • Comparative genomics to trace evolutionary trajectories

  • Role in Dictyostelium development: What specific functions does grlF serve during the Dictyostelium life cycle? Answering this requires:

    • Stage-specific knockout or knockdown studies

    • Phenotypic analysis under various environmental conditions

    • Integration with other developmental signaling pathways

Collaborative approaches combining expertise in structural biology, cell signaling, evolutionary biology, and Dictyostelium development would be most effective in addressing these questions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.