Recombinant Dictyostelium discoideum Metabotropic glutamate receptor-like protein J (grlJ)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Expression System:
GrlJ is recombinantly produced in E. coli with an N-terminal His tag for purification, yielding a full-length protein spanning residues 21–783 (UniProt ID: Q75JT4) .

Key Studies:

  1. Developmental Regulation:

    • grlJ¯ mutants exhibit precocious aggregation and impaired spore viability, highlighting GrlJ’s role in developmental timing .

    • GFP-tagged GrlJ localizes to plasma and internal membranes, confirming its receptor function .

  2. GPCR Signaling Pathways:

    • Phylogenetic analysis clusters GrlJ with GABA<sub>B</sub> receptor subtypes, suggesting conserved signaling roles .

    • Altered RasC and proteasome activity in polyP signaling pathways implicate cross-talk with GrlJ homologs .

Comparative Analysis of Grl Family Proteins

FeatureGrlJGrlD (Homolog)
Ligand BindingUncharacterizedBinds extracellular polyphosphate
Developmental RoleDelays aggregationInduces aggregation via polyP
Phenotype in KnockoutAccelerated developmentLoss of polyP sensing

Future Directions

  • Ligand identification: The specific ligand for GrlJ remains unknown, warranting binding assays with glutamate analogs or polyP derivatives.

  • Structural studies: Cryo-EM or X-ray crystallography could resolve its activation mechanism.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please specify them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for precise delivery time estimates.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have specific tag type requirements, please communicate them to us, and we will prioritize developing the specified tag.
Synonyms
grlJ; DDB_G0272150; Metabotropic glutamate receptor-like protein J
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-783
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
grlJ
Target Protein Sequence
SECKIAVLLSGSPNDLGYNYLMNEARVKAESELKLDFSIYYENLEESMEEAEKAFQDALH KGANLIVVGSFVHVGLGLKYAALTKDQDIYWIIRGNKRPNPDLPHVVILNFNSFELHYLL GYFSGLMTKTGIVGFVAPGPDVNTISTDNSFYLGAKYARPNITFLNVYVQSWYNPNVSYS AAKMLIKNGADLIGMSQDDMSCQKAMMDSGLIGIGATGYPTHLLFGGNVGVSYITNWTNL YVKYAQHVLNDDWPDYSSYFTNLSREDSIFIDDYSYKVPIDIQNLVNDEIQRLKNTSYIP YRSDPYLAQLGIPFDSKGLLVEDQFRANKKLLKGDSISKVIDFGQYSIPIEFIDYPNSLK YGVTIVSGVCIFICLVCMTLVVVFKKARVIKSSSPAFLLLILLGCCIIFAACILFAQSPT NQTCSARIWLLSLGYTLFLGNLLVKNWRIWLLFDNPKLKKRAITNWKLYPWVFAILAIDV MILAIWQGLGNINAESRIGYDSLTQYQYKNVCSSDDQGSIALYLLLVFHGLVLLVACFIS FKIKVVDIEEFNESKPITTSVYIITFCLFIVIPLMVSPQSLTSQTTIICVCAIVTTLISM LLLFGSKFYKMATQGLAINETFATSTKSSSKSSKSSYGKDNPNPNAINFGEDDTSDETSE EKHKSPKQKSVNFSNKSNSHLAVFTSDEETSKTSKLSIDFENSSKDISIDQLQQQKQQPI NTNGDLENKSNDKIDDDNDNSSVLSKRISNQQNGETEIDSNNV
Uniprot No.

Target Background

Function
May act during the development and be a negative regulator.
Database Links
Protein Families
BMP lipoprotein family; G-protein coupled receptor 3 family, GABA-B receptor subfamily
Subcellular Location
Cell membrane. Membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane. Golgi apparatus membrane. Nucleus envelope. Note=May also localize to internal membranes.

Q&A

What is GrlJ and what protein family does it belong to?

GrlJ is a member of the G-protein-coupled receptor (GPCR) family in Dictyostelium discoideum, specifically belonging to the family 3 of GPCRs, also known as the GABAB/glutamate-like receptor family. These receptors are characterized by a seven transmembrane region and are involved in signal transduction across the cell membrane. In higher eukaryotes, these receptors are primarily involved in neuronal signaling, but in Dictyostelium, they appear to have developmental regulatory functions. GrlJ is one of seventeen Family 3 members of GPCRs in Dictyostelium, which are denoted GrlA through GrlR .

What is the developmental role of GrlJ in Dictyostelium discoideum?

GrlJ functions as a negative regulator in Dictyostelium development, acting at several distinct developmental stages. Experimental evidence shows that inactivation of the grlJ gene leads to precocious development, with mutants completing their developmental cycle approximately 6 hours earlier than wild-type cells . This suggests that GrlJ's normal function is to moderate the pace of development. Additionally, GrlJ appears to be involved in the regulation of slug formation and spore development, as grlJ knockout mutants exhibit altered slug morphology and reduced spore viability .

What is the structural composition and cellular localization of GrlJ?

The protein contains several key structural features:

  • N-terminal extracellular domain involved in ligand binding

  • Seven-transmembrane domain characteristic of GPCRs

  • C-terminal intracellular domain likely involved in G-protein coupling

What phenotypic changes occur when GrlJ is knocked out?

The knockout of GrlJ (grlJ- mutants) results in several distinct phenotypic alterations:

  • Accelerated development: grlJ- mutants complete their developmental cycle approximately 6 hours earlier than wild-type cells .

  • Altered slug morphology: grlJ- slugs are longer than normal and frequently fragment during migration toward culmination .

  • Smaller fruiting bodies: Due to slug fragmentation, grlJ- cells form smaller but proportionate fruiting bodies .

  • Malformed spores: Spores from grlJ- fruiting bodies show morphological abnormalities .

  • Reduced spore viability: Despite normal synthesis and sensing of spore differentiation factors, the spores show decreased viability .

These phenotypic changes can be fully rescued by expressing a GFP-tagged full-length GrlJ protein in the mutant cells, confirming that these effects are specifically due to the absence of GrlJ .

How does GrlJ relate to metabotropic glutamate receptors (mGluRs) in higher organisms?

Phylogenetic analyses of related receptors like DdmGluPR (another Dictyostelium mGluR-like protein) suggest that these proteins diverged after the mGluR family-GABA(B) receptors split but before the diversification within the mGluR family . This implies that Dictyostelium receptors like GrlJ may represent evolutionary intermediates that can provide insights into the ancestral functions of this receptor family before its specialization for neuronal signaling in higher organisms.

What are the optimal conditions for expressing recombinant GrlJ protein?

For successful expression of recombinant GrlJ protein, the following methodological approach is recommended:

  • Expression System: E. coli has been successfully used for recombinant GrlJ expression . The protein can be expressed as a His-tagged fusion protein to facilitate purification.

  • Construct Design: The optimal construct includes amino acids 21-783 of the GrlJ sequence fused to an N-terminal His-tag .

  • Storage Conditions: After purification, the protein should be stored as a lyophilized powder. For working solutions, reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol (final concentration) to prevent protein degradation during freeze-thaw cycles .

  • Buffer Conditions: Tris/PBS-based buffer at pH 8.0 with 6% trehalose has been successfully used for storage .

  • Temperature Considerations: Store working aliquots at 4°C for up to one week. For long-term storage, keep at -20°C/-80°C, avoiding repeated freeze-thaw cycles .

What methodologies are most effective for studying GrlJ function during Dictyostelium development?

To effectively investigate GrlJ function during Dictyostelium development, researchers should consider the following approaches:

  • Gene Knockout Studies: Creating grlJ- mutants through homologous recombination allows observation of developmental phenotypes in the absence of GrlJ. This approach has revealed GrlJ's role as a negative regulator of development .

  • GFP-Tagging for Localization: Expressing GFP-tagged GrlJ enables real-time visualization of protein localization during different developmental stages. This method has confirmed GrlJ's presence in both plasma membrane and internal membrane compartments .

  • Developmental Timing Assays: Comparing the timing of developmental milestones between wild-type and grlJ- cells provides quantitative data on GrlJ's regulatory effects. These assays should monitor key developmental events from starvation-induced aggregation through fruiting body formation .

  • Spore Viability Testing: Assessing spore morphology and viability through germination assays can quantify the effects of GrlJ on terminal differentiation .

  • Rescue Experiments: Reintroducing wild-type GrlJ into grlJ- cells should restore normal developmental timing and spore formation, confirming phenotype specificity .

How can researchers effectively analyze GrlJ signaling pathways in Dictyostelium?

To elucidate GrlJ signaling pathways, researchers should implement these methodological approaches:

  • Transcriptomic Analysis: RNA sequencing of wild-type versus grlJ- cells during development can identify downstream genes regulated by GrlJ signaling. Similar approaches have been used to study transcriptional responses in Dictyostelium exposed to different bacteria .

  • G-protein Interaction Studies: As a GPCR, GrlJ likely signals through specific G-proteins. Co-immunoprecipitation experiments with tagged GrlJ can identify associated G-protein subunits.

  • Second Messenger Assays: Measuring changes in second messengers (cAMP, calcium, etc.) following stimulation or inhibition of GrlJ can clarify downstream signaling events.

  • Comparative Analysis with Related Receptors: Studies comparing GrlJ with other Dictyostelium GPCRs like GrlG, which has been implicated in multicellular development and cooperation , may reveal common signaling mechanisms or regulatory pathways.

  • Developmental Stage-Specific Analysis: Since GrlJ functions at multiple developmental stages, stage-specific experimental designs are necessary to dissect its differential roles throughout the life cycle.

What approaches can reliably determine GrlJ ligand specificity?

Although the natural ligand for GrlJ has not been definitively identified, researchers can employ these methods to investigate ligand specificity:

  • Structural Analysis: Comparing the ligand-binding domain of GrlJ with well-characterized mGluRs may predict potential ligands. In similar receptors like DdmGluPR, residues involved in binding the alpha-carboxylic and alpha-amino groups of glutamate are conserved, while residues interacting with the gamma-carboxylic group are not .

  • Binding Assays: Developing in vitro binding assays using purified recombinant GrlJ protein and candidate ligands can provide direct evidence of interaction.

  • Functional Assays: Testing the ability of candidate ligands to trigger GrlJ-dependent responses in cell-based assays can confirm biological activity.

  • Mutational Analysis: Systematic mutation of predicted ligand-binding residues can validate structural models and confirm the binding mechanism.

  • Comparative Pharmacology: Testing ligands known to activate related receptors like GABAB receptors or mGluRs may identify cross-reactive compounds that can serve as experimental tools.

How does GrlJ contribute to Dictyostelium's multicellular development?

GrlJ plays multiple roles in regulating Dictyostelium's transition from unicellular to multicellular states:

  • Developmental Timing Regulation: GrlJ functions as a negative regulator of development, as evidenced by the accelerated development in grlJ- mutants . This temporal control is crucial for coordinating the complex sequence of events during multicellular formation.

  • Slug Morphology and Integrity: The observation that grlJ- slugs are longer and tend to fragment suggests that GrlJ contributes to maintaining proper cell-cell adhesion or coordinated cell movement during the migratory slug phase .

  • Spore Formation and Viability: GrlJ influences terminal differentiation into viable spores, a critical aspect of Dictyostelium's life cycle that ensures survival under unfavorable conditions .

  • Potential Signal Integration: Like other GPCRs in Dictyostelium, GrlJ may integrate environmental cues with developmental decisions, similar to how the related GPCR family member GrlG has been implicated in cooperative development .

Understanding these contributions requires integrating findings from developmental biology, cell signaling, and evolutionary biology perspectives.

What are common challenges in purifying functional recombinant GrlJ and how can they be addressed?

Researchers working with recombinant GrlJ may encounter several challenges:

  • Insolubility and Inclusion Body Formation: As a membrane protein with multiple transmembrane domains, GrlJ may form inclusion bodies when expressed in E. coli.

    • Solution: Optimize expression conditions by lowering temperature (16-20°C), using specialized E. coli strains (e.g., C41/C43), or exploring fusion tags that enhance solubility.

  • Protein Misfolding: Improper folding can yield non-functional protein.

    • Solution: Consider expression in eukaryotic systems or use of chaperone co-expression strategies. The successful expression in E. coli described in the literature suggests optimized protocols exist .

  • Protein Degradation: Proteolytic degradation during purification.

    • Solution: Include protease inhibitors during purification and minimize freeze-thaw cycles by storing at 4°C for short-term use .

  • Post-translational Modifications: Bacterial expression systems lack eukaryotic post-translational modifications.

    • Solution: For studies requiring native modifications, consider expression in Dictyostelium itself or other eukaryotic systems.

  • Protein Activity Loss: Loss of functional activity during purification or storage.

    • Solution: Use the recommended storage conditions with 6% trehalose in Tris/PBS buffer (pH 8.0) and add glycerol (5-50%) to aliquots for long-term storage .

How can researchers effectively assess GrlJ knockout phenotypes in different developmental conditions?

To thoroughly characterize GrlJ knockout phenotypes across varied conditions:

  • Standardized Development Assays:

    • Use defined cell densities (1 × 10^7 cells/mL) on nutrient-free agar

    • Document development at regular intervals (2-hour increments)

    • Quantify timing of key developmental milestones (aggregation, mound formation, slug formation, culmination)

  • Environmental Variable Testing:

    • Assess phenotypes under different temperatures (15°C, 22°C, 27°C)

    • Test development on substrates with varying hardness/buffering capacity

    • Examine development under different humidity conditions

  • Mixed Population Experiments:

    • Co-develop wild-type and grlJ- cells (labeled with different fluorescent markers)

    • Assess competitive fitness and potential "cheating" behavior

    • Quantify relative contribution to spore vs. stalk cell populations

  • Stress Response Analysis:

    • Test development following exposure to oxidative stress

    • Assess response to osmotic challenges

    • Examine starvation response kinetics

  • Quantitative Phenotyping Metrics:

    • Measure slug migration distance and speed

    • Quantify fruiting body dimensions and spore yields

    • Assess spore germination efficiency under standardized conditions

What methodological approaches can distinguish between direct and indirect effects of GrlJ on gene expression?

Distinguishing direct versus indirect GrlJ effects requires sophisticated experimental designs:

  • Temporal Gene Expression Analysis:

    • Perform RNA-seq at closely spaced time points following developmental initiation

    • Compare expression kinetics between wild-type and grlJ- cells

    • Identify immediate-early versus delayed gene expression changes

  • Inducible GrlJ Systems:

    • Develop tetracycline-inducible or similar systems for controlled GrlJ expression

    • Identify gene expression changes occurring rapidly after induction (likely direct)

    • Use protein synthesis inhibitors to block secondary transcriptional responses

  • Chimeric Receptor Approaches:

    • Create chimeric receptors with GrlJ intracellular domains but heterologous ligand-binding domains

    • Trigger signaling with defined ligands and assess rapid transcriptional responses

    • Compare signaling outputs across different chimeric constructs

  • Chromatin Immunoprecipitation Studies:

    • Identify transcription factors activated downstream of GrlJ signaling

    • Perform ChIP-seq to map transcription factor binding sites

    • Correlate binding events with gene expression changes

  • Pathway Perturbation Analysis:

    • Systematically inhibit candidate signaling pathways downstream of GrlJ

    • Identify which gene expression changes are blocked by specific inhibitors

    • Construct pathway models based on inhibition patterns

How does GrlJ function compare with other GPCR family members in Dictyostelium?

The Dictyostelium genome encodes seventeen Family 3 GPCRs (GrlA-GrlR), allowing for comparative functional analysis:

  • Developmental Regulation Patterns:

    • GrlJ functions as a negative regulator of development

    • In contrast, another family member, GrlG, has been implicated in cooperative multicellular development

    • These distinct roles suggest functional specialization among family members

  • Expression Profiles:

    • GrlJ transcripts are detected throughout development with increased levels during early and late developmental stages

    • Similar to GrlJ, the related receptor DdmGluPR shows high expression in vegetative cells and early development (until 4 hours after starvation)

    • Comparing temporal expression patterns across family members may reveal coordinated regulatory networks

  • Knockout Phenotypes:

    • GrlJ knockout accelerates development

    • DdmGluPR-null cells show delayed aggregate formation upon starvation and impaired chemotaxis toward cAMP

    • GrlG mutations are associated with decreased cooperation in multicellular development

    • These contrasting phenotypes suggest complementary roles in regulating different aspects of development

  • Evolutionary Significance:

    • Phylogenetic analysis of similar receptors like DdmGluPR suggests they diverged after the mGluR family-GABA(B) receptors split but before mGluR family diversification

    • GrlG shows evidence of parallel evolution associated with cooperative behaviors

    • Comparative evolutionary analysis can provide insights into the ancestral functions of this receptor family

What insights can GrlJ research provide about the evolution of signaling systems across species?

Research on GrlJ offers valuable evolutionary perspectives on signaling system development:

  • Ancestral GPCR Functions:

    • The presence of mGluR-like receptors in Dictyostelium suggests these signaling systems evolved before the divergence of animals and social amoebae

    • Studying GrlJ provides insights into the original functions of these receptors before their specialization for neuronal signaling in animals

  • Signaling System Repurposing:

    • While mGluRs function primarily in neuronal signaling in animals, Dictyostelium uses similar receptors for developmental regulation

    • This functional shift demonstrates how core signaling mechanisms can be repurposed for different biological processes during evolution

  • Conservation of Structural Elements:

    • Comparing ligand-binding domains between GrlJ and vertebrate mGluRs can identify conserved structural elements essential for receptor function

    • Analysis of related receptors shows conservation of specific glutamate-binding residues across evolutionarily distant species

  • Parallel Evolution Patterns:

    • Evidence for parallel evolution has been observed in the related receptor GrlG during experimental evolution studies

    • Such patterns suggest strong selective pressures on GPCR signaling systems during the evolution of multicellularity

  • Developmental Signaling Integration:

    • Understanding how GrlJ integrates with other signaling systems in Dictyostelium provides a model for studying the evolution of complex developmental regulatory networks

    • The interplay between GrlJ and cAMP signaling components may represent fundamental signaling network architectures conserved across diverse species

What emerging technologies could advance GrlJ functional characterization?

Several cutting-edge approaches hold promise for deepening our understanding of GrlJ:

  • CRISPR-Cas9 Domain-Specific Editing:

    • Precise modification of specific GrlJ domains rather than complete gene knockout

    • Creation of domain-swap chimeras between GrlJ and related receptors

    • Introduction of point mutations to test structural predictions about ligand binding or G-protein coupling

  • Advanced Live Imaging Techniques:

    • Super-resolution microscopy for detailed visualization of GrlJ trafficking

    • FRET-based biosensors to measure GrlJ activation in real-time

    • Optogenetic tools to trigger GrlJ signaling with spatial and temporal precision

  • Single-Cell Transcriptomics:

    • Analysis of cell-to-cell variability in GrlJ expression and signaling responses

    • Identification of distinct cell populations with different GrlJ-dependent transcriptional profiles

    • Tracking developmental trajectories in wild-type versus grlJ- cells

  • Cryo-EM Structural Analysis:

    • Determination of GrlJ three-dimensional structure at high resolution

    • Visualization of conformational changes upon activation

    • Identification of potential ligand-binding sites and protein-protein interaction interfaces

  • Synthetic Biology Approaches:

    • Engineering of synthetic GrlJ variants with novel properties

    • Creation of synthetic developmental circuits incorporating GrlJ signaling

    • Design of artificial multicellular systems dependent on GrlJ regulation

How might GrlJ research contribute to broader understanding of developmental signaling networks?

GrlJ research has significant implications for understanding fundamental developmental processes:

  • Temporal Coordination Mechanisms:

    • GrlJ's role as a negative regulator suggests it functions in timing developmental transitions

    • Understanding how such "developmental brakes" integrate with positive regulators could reveal general principles of developmental timing

  • Multicellularity Evolution Models:

    • The function of GrlJ in Dictyostelium's facultative multicellularity provides insights into the signaling systems required for evolutionary transitions to multicellular organization

    • Comparisons with related receptors like GrlG that show parallel evolution in multicellular contexts offer unique evolutionary perspectives

  • Signaling Network Robustness:

    • Analysis of how GrlJ-dependent and independent pathways interact may reveal principles of developmental robustness

    • Understanding compensatory mechanisms that operate in grlJ- cells could illuminate general principles of signaling network resilience

  • Environmental Signal Integration:

    • GrlJ may participate in integrating environmental cues with developmental decisions

    • This integration is fundamental to developmental plasticity across diverse organisms

  • Cell Fate Decision Models:

    • GrlJ's involvement in spore formation highlights its potential role in cell fate decisions

    • Comparative analysis with other developmental regulators could reveal conserved principles of cell fate specification

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.