Recombinant Dictyostelium discoideum Metabotropic glutamate receptor-like protein O (grlO)

Shipped with Ice Packs
In Stock

Description

Overview and Classification

Recombinant Dictyostelium discoideum Metabotropic Glutamate Receptor-Like Protein O (GrlO) is a member of the Family 3 G-protein-coupled receptors (GPCRs) encoded by the grlO gene. This family comprises 17 receptors (GrlA–GrlR) in D. discoideum, which share structural and functional similarities with animal metabotropic glutamate receptors (mGluRs) and γ-aminobutyric acid B (GABA<sub>B</sub>) receptors . GrlO is classified as G-protein-coupled receptor family 3 protein 14 and is implicated in sensing extracellular ligands to regulate developmental and environmental responses .

Recombinant Production

GrlO is produced recombinantly using heterologous expression systems:

  • Expression Systems: Cell-free expression, E. coli, yeast, or mammalian cells .

  • Purification: Affinity chromatography (e.g., Ni-NTA for His-tagged variants) .

  • Functional Assays: Ligand-binding studies and G-protein activation assays (methods inferred from related Grl proteins) .

Research Gaps and Future Directions

  • Ligand Specificity: The endogenous ligand(s) for GrlO remain unidentified.

  • Knockout Phenotypes: No published studies describe grlO<sup>−</sup> mutants.

  • Cross-Species Homology: GrlO lacks direct orthologs in vertebrates, limiting comparative analyses .

Table 2: Grl Family Members in D. discoideum

ProteinAlternative NameKnown FunctionsCitation
GrlAG-protein-coupled receptorDownregulated during bacterial exposure
GrlGFar2Folate receptor; regulates phagocytosis
GrlJFamily 3 protein 9Delays development; affects spore viability
GrlOFamily 3 protein 14Hypothesized role in environmental sensing

Applications in Research

  • Signal Transduction Studies: Tools for dissecting GPCR signaling in a genetically tractable model .

  • Evolutionary Biology: Insights into the origin of Family 3 GPCRs predating animal-fungal divergence .

  • Drug Discovery: Screening platform for novel GPCR ligands (given structural conservation with human receptors) .

References

  1. LabPrice (2021). Recombinant D. discoideum GrlO storage guidelines .

  2. PMC (2007). Functional characterization of Grl family receptors .

  3. Frontiers in Microbiology (2020). Transcriptional regulation of Grl proteins .

  4. Universität zu Köln (Thesis). Grl family classification and expression .

  5. MyBioSource (2014). Recombinant GrlO production details .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a 6-month shelf life at -20°C/-80°C. Lyophilized form has a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
grlO; DDB_G0271688; Metabotropic glutamate receptor-like protein O
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-819
Protein Length
Full Length of Mature Protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
grlO
Target Protein Sequence
NKNICKISLLLSGDYNDIGVNYMFNYARTQVEKNLNINSIVFTNLENNQNAINNAIIESI NKGSNFLISTINSHSNFIINYSRLYKNKEIFWLIKGNDNERPIPDDLPRVKILNINSDLS FYYLGFISSLISKTGKIGFISTKNIETDYQRLTNAFYIGAINSNPNITFLVCSNNFNNQN NNKKISYKISKLLISKGVDFIGSDQDDNSIQLAVIDNGGIGLGLTGFEYSKIYNDKFPFS FKLEWSQLLIDITNTIINGSWVDYDIIYITSFSRLNGTTNFTPEIEPIINYNFIPKIYQK QINDEINKLKNHSTNYYFPHLCNNLFNNIYNQKQTNGCITNEQFSNSHLLNASNIKIIDN KEILEFVDSYSNSIKISILSVSIFCIFICVLGMIFITVLRNARILKSSSPSFLLLILFGC IVIFTGCILFSQPATDKTCQGRVWLLSIGYTIFLGSLLIKNWRVWLLFDNKKLRKRSITN WKLYPWVAGILVVDVLILALWQGLGDIKSESRIIGTSFYQYTNVCTNNDQGSIALYILLA FHGLKLLGTCFISFKIKLVDIEEFNESKPITTSVFIILFCIFTIILLIAPSSSSSSASSP QPIASLETIICICSVTTTAISIGLLFGDKIYFITTQGLGLNQTFAKSSSFSLDKKDCDDD DDDSSDGSDHSNSNKNKNKNKNRNQSEKKKRPNSIKPIGLFSKSKQESVVFNPPSNNDLT NELALPIEGIKEGHGHDSENNDEYEHHEDEDHEYEGEGEDEDHEDEYEVENDIEQEQEQE SSNISISTKKNNENEIISDT
Uniprot No.

Target Background

Database Links
Protein Families
BMP lipoprotein family; G-protein coupled receptor 3 family, GABA-B receptor subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2024 Thebiotek. All Rights Reserved.