Recombinant Dictyostelium discoideum Mitochondrial import inner membrane translocase subunit tim50 (timm50)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Dictyostelium discoideum Mitochondrial Import Inner Membrane Translocase Subunit Tim50 (Tim50)

Tim50 is a key component of the TIM23 complex, which is essential for transporting proteins into the mitochondrial inner membrane . It plays a crucial role in recognizing and binding to the presequence, or mitochondrial targeting signal, found on the proteins destined for import . Dictyostelium discoideum is a slime mold often used in biological research to study various cellular processes.

Tim50's Role in Maintaining Mitochondrial Function

Tim50 is involved in maintaining mitochondrial structure, dynamics, and lipid metabolism . It also helps manage stress within the mitochondria .

TIMM50 in Cardiac Function

Tim50 interacts with cardiolipin in the MIM, preventing proton leakage through the TIM23 channel . Cardiolipin synthesis starts from phosphatidic acid (PA) translocated from the ER via ERMES. TIMM50 depletion shows similar phenotypes to those seen in Barth syndrome, suggesting Tim50 plays a role in cardiolipin composition in mitochondria .

Table 1: Effects of TIMM50 Deficiency

EffectDescription
Mitochondrial DysfunctionMutations in TIMM50 cause multiple mitochondrial bioenergetic dysfunctions .
Protein ImportTIMM50 facilitates the import of approximately 60% of mitochondrial proteins .
Neurological EffectsHuman TIMM50 mutations lead to neurological issues, including mitochondrial epileptic encephalopathy and intellectual disability .
Mitochondrial TraffickingTIMM50 deficiency impairs mitochondrial trafficking in neuronal cells, leading to more static mitochondria .
ATP LevelsTIMM50 knockdown (KD) leads to a significant reduction in cellular ATP levels .
Cardiolipin InteractionTIMM50 interacts with cardiolipin in the MIM, preventing proton leakage through the TIM23 channel .
3β-HSD2 StabilityTIMM50 acts as a chaperone by interacting with partially unfolded 3β-HSD2 and CyP450ssc, playing a crucial role in early steps of steroid hormone production .
Mitochondrial Membrane PotentialTbTim50 KD reduces mitochondrial membrane potential in T. brucei, while overexpression increases it .
Phosphatase ActivityTbTim50 possesses protein- and lipid phosphatase activities .

Clinical Significance and Recent Research

Mutations in the TIMM50 gene in humans have been linked to severe diseases, including mitochondrial epileptic encephalopathy, developmental delay, optic atrophy, cardiomyopathy, and 3-methylglutaconic aciduria .

Impact of TIMM50 Deficiency on Mitochondrial Proteome in Neurons

In TIMM50 KD neurons, many MIM and matrix proteins were detected via mass spectrometry . The levels of OXPHOS and MRP subunits were mostly downregulated, though to a lesser extent than in patient fibroblasts . There was no effect on mitochondrial DNA levels, confirming that the observed effects on OXPHOS and MRP protein levels were a direct result of TIMM50 deficiency .

TIMM50 KD Impairs Mitochondrial Trafficking in Neuronal Cells

TIMM50 deficiency causes neuronal cell mitochondria to be more static, which can lead to energy deprivation in regions where mitochondria are needed but cannot be shipped .

Table 2: Comparison of TIMM50 isoforms

FeatureTIMM50L (Long Isoform)TIMM50S (Short Isoform)
Amino Acid Length456353
LocalizationNucleusMitochondria
Nuclear Localization SignalPresentAbsent
FunctionTargeted to the nucleus due to the presence of an internal NLS Found in mitochondria as part of the TIM23 complex
Transmembrane DomainHas a helical TMD Has a helical TMD
Serine Phosphatase DomainFunctional FCP1-like domain Functional FCP1-like domain
MTSPredicted N-terminal MTS with low similarity between the two isoforms Predicted N-terminal MTS with low similarity between the two isoforms

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
timm50; DDB_G0270196; Mitochondrial import inner membrane translocase subunit tim50
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
49-374
Protein Length
Full Length of Mature Protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
timm50
Target Protein Sequence
PKKEEPKSEQQKKVEDKTEEKEKEKDEEENENEKEKENEDGEGQKKKSKFNVPPIVTSVT STFFAGVLVASTFGYLTYNFKKDISEEERYRLNSVESKFYHSIAEPFREFFDNIFENLRT KYEFFDMLFGPGKIHKVLPPPLPGGKKYTLVIDIDALTEITKTSKYPTLYKRAGLDFFLD HLRKDYEIYLYFNGNIPQNKYEQLQFKIDTNGKYFTGLLYPETGIKERNQFSKKIEMLDR DPSKVIFIDAASPYDHPNVINIGKFKSNSKDKLLIELLPVLESFSRKNLDDVRPEISQFQ NISKQSLTKNLEDYLSTHNINSRQKK
Uniprot No.

Target Background

Function
A component of the mitochondrial import inner membrane translocase. It mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.
Database Links
Protein Families
TIM50 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

How does Tim50 contribute to the mitochondrial protein import pathway?

Tim50 plays a crucial role in the transfer of preproteins from the Translocase of the Outer Membrane (TOM) complex to the TIM23 complex through the intermembrane space . The protein functions as the primary receptor of the TIM23 complex, which is the main entry gate for proteins destined for the matrix and inner membrane. Experimental studies show that mitochondria depleted of Tim50 display strongly reduced import kinetics of preproteins that use the TIM23 complex, while the TIM22 pathway remains unaffected . This indicates Tim50's specificity in the TIM23-dependent protein import pathway.

What are the main domains of Tim50 and their significance?

Tim50 contains two functionally distinct domains:

  • Core Domain: This domain is essential for recruitment of Tim50 to the TIM23 complex and forms the foundation of Tim50's structure.

  • Presequence-Binding Domain (PBD): This domain is responsible for interaction with precursor proteins and the TOM complex.

Both domains are essential for viability in yeast, and deletion of either domain is lethal. Interestingly, when co-expressed in trans (as separate polypeptides), the two domains can functionally complement each other to support Tim50's role, though with some growth limitations at elevated temperatures .

DomainApproximate LocationPrimary FunctionInteraction Partners
Core DomainResidues ~132-365Recruitment to TIM23 complexTim23, Tim17
PBDResidues ~366-476Presequence bindingPrecursor proteins, Tom22

What are the recommended protocols for expressing and purifying recombinant D. discoideum Tim50?

For expression and purification of recombinant D. discoideum Tim50, the following protocol is recommended based on established methods:

  • Expression System: E. coli is suitable for expression of full-length D. discoideum Tim50 (residues 49-374) with an N-terminal His-tag .

  • Purification Method:

    • Use affinity chromatography with a Ni-NTA column for initial purification

    • Apply buffer containing Tris/PBS (pH 8.0) with 6% Trehalose

    • Store the purified protein as a lyophilized powder or in aliquots with 50% glycerol

  • Reconstitution:

    • Centrifuge the vial briefly before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol (recommended final concentration 50%) and store in aliquots at -20°C/-80°C

  • Quality Control:

    • Verify purity by SDS-PAGE (>90% purity is standard)

    • Avoid repeated freeze-thaw cycles; store working aliquots at 4°C for up to one week

How can researchers validate the functionality of recombinant Tim50 in experimental systems?

To validate the functionality of recombinant D. discoideum Tim50, researchers should consider these approaches:

  • Binding Assays:

    • Perform co-immunoprecipitation experiments to assess interaction with Tim23 and Tim17

    • Use cross-linking assays to detect binding to preproteins that are halted at the TOM complex level

  • Import Assays:

    • Conduct in vitro protein import assays using isolated mitochondria

    • Compare import kinetics of matrix-targeted precursors in Tim50-depleted versus control mitochondria

    • Use fluorescently labeled precursor proteins to visualize import in real-time

  • Functionality Testing in Tim50-depleted Systems:

    • Express recombinant Tim50 in Tim50-depleted cells or mitochondria

    • Measure rescue of protein import defects

    • Assess restoration of interaction with other TIM23 complex components

  • Domain-specific Functionality:

    • Use the "50split" approach (co-expression of separate core domain and PBD) to assess domain-specific functions

    • Compare results with full-length Tim50 to identify any functional deficiencies

How can D. discoideum Tim50 be used as a model for studying human mitochondrial disease mechanisms?

D. discoideum offers unique advantages as a model system for studying mitochondrial diseases related to Tim50/TIMM50 dysfunction:

  • Evolutionary Conservation:

    • Many mitochondrial proteins, including components of import machinery, are conserved between D. discoideum and humans

    • D. discoideum has been validated as a model for investigating proteins implicated in neurological disorders

  • Experimental Approach:

    • Generate Tim50-knockout strains and assess mitochondrial function

    • Complement with human TIMM50 to study conservation of function

    • Introduce disease-associated mutations to study pathological mechanisms

    • Analyze effects on mitochondrial proteome using the mitochondrial protein compendium developed for D. discoideum

  • Neurological Disease Relevance:

    • Mitochondrial dysfunction is implicated in various neurological conditions

    • D. discoideum has been successfully used to study proteins involved in Alzheimer's, Parkinson's, and Huntington's diseases

    • The unique lifecycle of D. discoideum provides diverse phenotypic "readouts" of cytopathological pathways, offering insights not available in other models

What strategies can be employed to study Tim50 interaction partners in the mitochondrial import machinery?

To comprehensively map Tim50 interaction networks:

  • Proximity-based Labeling:

    • Fuse BirA* or APEX2 to specific domains of Tim50

    • Identify proximal proteins through biotinylation followed by streptavidin pulldown and mass spectrometry

    • Compare interactomes of different Tim50 domains (core vs. PBD)

  • Cross-linking Mass Spectrometry (XL-MS):

    • Apply chemical cross-linkers to stabilize transient interactions

    • Identify cross-linked peptides using mass spectrometry

    • Map interaction interfaces at the amino acid level

  • Mutagenesis Analysis:

    • Create a library of Tim50 point mutations using random mutagenesis

    • Screen for temperature-sensitive mutants defective in protein import

    • Map critical residues for Tim50-Tim23 interaction

    • Results from similar studies in other organisms have identified two distinct patches on the surface of Tim50 that are important for interaction with Tim23

  • Co-immunoprecipitation with Domain-specific Antibodies:

    • Use antibodies directed against specific domains of Tim50

    • Analyze co-precipitated proteins to determine domain-specific interactions

    • This approach has revealed that the core domain and PBD of Tim50 may not strongly interact with each other

What are common challenges in working with recombinant D. discoideum Tim50 and how can they be addressed?

Researchers commonly encounter these challenges when working with recombinant D. discoideum Tim50:

  • Protein Solubility Issues:

    • Challenge: Tim50 contains a transmembrane segment that can cause aggregation

    • Solution: Express only the soluble domains for specific applications, or use appropriate detergents like digitonin for full-length protein

    • Alternative: Co-express with interaction partners to improve folding and solubility

  • Functionality Validation:

    • Challenge: Confirming that recombinant protein retains native functionality

    • Solution: Use functional complementation assays in Tim50-depleted systems

    • Alternative: Design domain-specific assays based on the "50split" approach

  • Antibody Availability:

    • Challenge: Limited commercial antibodies for D. discoideum proteins

    • Solution: Use recombinant antibody technologies like phage display

    • Alternative: Sequence existing hybridoma antibodies to create recombinant versions

  • Expression System Selection:

    • Challenge: Choosing optimal expression system for functional protein

    • Solution: E. coli works well for full-length mature protein (residues 49-374)

    • Alternative: Consider insect cell expression for improved post-translational modifications

How can researchers distinguish between effects on membrane potential and direct effects on protein import when studying Tim50 function?

This is a critical methodological consideration, as Tim50 depletion can affect both protein import and membrane potential:

  • Control Experiments:

    • Measure membrane potential (ΔΨ) directly using fluorescent dyes like JC-1 or TMRM

    • Compare import of different classes of precursor proteins that require different threshold levels of ΔΨ

    • Previous studies show Tim50 depletion may reduce membrane potential by 20-30%

  • Direct Comparison Strategy:

    • Use adenine nucleotide carrier (AAC) import as a control, as it uses the TIM22 pathway not directly dependent on Tim50

    • If AAC import is normal while matrix-targeted precursor import is impaired, effects are likely specific to Tim50 function rather than secondary to membrane potential changes

  • Temporal Analysis:

    • Perform time-course experiments to determine if membrane potential changes precede or follow protein import defects

    • Use inducible depletion systems to observe early versus late effects of Tim50 loss

  • Rescue Experiments:

    • Attempt to restore membrane potential without rescuing Tim50 function

    • If protein import defects persist despite normalized membrane potential, they are likely direct effects of Tim50 dysfunction

How can structural studies of D. discoideum Tim50 inform therapeutic strategies for mitochondrial disorders?

Structural studies of D. discoideum Tim50 offer promising avenues for therapeutic development:

  • Structure-based Drug Design:

    • Determine high-resolution structures of Tim50 domains using X-ray crystallography or cryo-EM

    • Identify druggable pockets, particularly at protein-protein interaction interfaces

    • Design small molecules that could modulate Tim50 function in disease states

    • The identification of two distinct interaction patches on Tim50 provides potential targets for therapeutic intervention

  • Peptide Therapeutics Approach:

    • Design peptides based on the presequence-binding domain (PBD) that could enhance mitochondrial protein import

    • Develop cell-penetrating peptides that mimic Tim50 functional domains

    • Use D. discoideum as a screening platform for peptide efficacy

  • Comparative Structural Biology:

    • Compare structures of D. discoideum Tim50 with human TIMM50

    • Identify conserved versus divergent regions to inform species-specific therapeutic strategies

    • Focus on regions implicated in protein-protein interactions with Tim23 and precursor proteins

What are the implications of studying Tim50 function for understanding the evolution of mitochondrial import systems?

Studying Tim50 in D. discoideum provides evolutionary insights into mitochondrial import systems:

  • Evolutionary Conservation Analysis:

    • Compare Tim50 sequences and structures across species from unicellular eukaryotes to mammals

    • Identify core conserved features that represent essential functional elements

    • Map species-specific adaptations that might relate to metabolic or developmental differences

  • Functional Conservation Testing:

    • Express Tim50 from different species in D. discoideum Tim50-null backgrounds

    • Assess cross-species complementation to determine functional conservation

    • Identify species-specific interaction partners through comparative proteomics

  • Developmental Context:

    • Study Tim50 function during the unique developmental cycle of D. discoideum

    • Compare requirements for Tim50 function during unicellular versus multicellular stages

    • This approach leverages D. discoideum's unique lifecycle, which provides diverse phenotypic responses to mitochondrial dysfunction

  • Integration with Mitochondrial Protein Compendium:

    • Use the D. discoideum mitochondrial protein compendium to identify evolutionary patterns in mitochondrial protein import pathways

    • Compare protein import requirements across evolutionary diverse organisms

    • Identify lineage-specific adaptations in the TIM23 complex

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.