Recombinant Dictyostelium discoideum Mitochondrial substrate carrier family protein ancA (ancA)

Shipped with Ice Packs
In Stock

Description

3.1. Substrate Binding Mechanism

AncA adopts a cytoplasmic (c-) state when binding substrates, with its cavity open to the cytosol and closed to the mitochondrial matrix . Substrate-induced perturbation of salt bridges triggers conformational changes for transport .

3.2. Stability and Aggregation Resistance

Despite D. discoideum’s proteome being rich in aggregation-prone Q/N residues , recombinant ancA remains soluble under standard conditions. This stability is attributed to:

  • Lyophilization with trehalose .

  • Robust proteostatic mechanisms in D. discoideum, including chaperone-mediated folding .

Applications in Mitochondrial Research

Recombinant ancA is used to:

  • Study substrate translocation mechanisms in mitochondrial carriers .

  • Model human MSC family disorders linked to mutations in SLC25 genes (e.g., encephalomyopathies, epilepsy) .

  • Screen inhibitors targeting ADP/ATP transport in pathogenic mitochondria .

Comparative Analysis of Mitochondrial Carriers

FeatureancAHuman SLC25A10
SubstrateADP/ATPMalate/α-ketoglutarate
Disease AssociationNot reportedEpileptic encephalopathies
Structural StateCytoplasmic (c-) conformation Matrix-open conformation

Key Challenges and Future Directions

  • Functional Redundancy: AncA’s role overlaps with other MSC family members in D. discoideum, necessitating knockout studies .

  • Thermostability: Lyophilization improves shelf life, but long-term storage requires -80°C .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we understand that specific requirements may exist. If you have a preferred format, kindly indicate it during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. Should you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for a maximum of one week.
Reconstitution
For optimal reconstitution, it is recommended to briefly centrifuge the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference for your own applications.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein itself. Generally, liquid forms exhibit a shelf life of 6 months at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses to minimize freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please inform us if you have a specific tag type preference, and we will prioritize its inclusion during development.
Synonyms
ancA; DDB_G0267454; Mitochondrial substrate carrier family protein ancA; ADP,ATP carrier protein; ADP/ATP translocase; Adenine nucleotide translocator; ANT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
ancA
Target Protein Sequence
MSNQKKNDVSSFVKDSLIGGTAGGVSKTIVAPIERVKLLLQVQSASTQIAADKQYKGIVD CFVRVSKEQGVISLWRGNLANVIRYFPTQALNFAFKDKYKKFFVRHTAKENPTKFFIGNL LSGGAAGATSLLFVYPLDFARTRLAADVGTGSARQFTGLGNCISSIYKRDGLIGLYRGFG VSVGGIFVYRAAFFGGYDTAKGILLGENNKKASFWASWGIAQVVTTIAGVVSYPFDTVRR RMMMQAGRADILYSSTWDCWVKIATREGPTAFFKGALSNAIRGSGGALVLVIYDEIQKLM GFEGGVGSE
Uniprot No.

Target Background

Function
ADP:ATP antiporter mediating the import of ADP into the mitochondrial matrix for ATP synthesis and the export of ATP to fuel cellular processes. It cycles between the cytoplasmic-open state (c-state) and the matrix-open state (m-state), operating via the alternating access mechanism with a single substrate-binding site exposed intermittently to either the cytosolic (c-state) or matrix (m-state) side of the inner mitochondrial membrane.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is ancA protein and what is its role in Dictyostelium discoideum?

ancA (UniProt ID: O97470) is a 309-amino acid mitochondrial substrate carrier family protein in Dictyostelium discoideum that functions as an ADP/ATP translocase, facilitating the exchange of ADP and ATP across the mitochondrial membrane. This protein plays a critical role in cellular energy metabolism by importing ADP into the mitochondrial matrix and exporting ATP to the cytosol to fuel cellular processes .

In Dictyostelium discoideum, a soil-dwelling social amoeba used extensively as a eukaryotic model organism, this energy transport function is essential for numerous cellular processes including chemotaxis, development, and the transition from unicellular to multicellular states during its life cycle .

How does ancA relate to other mitochondrial carrier proteins?

ancA belongs to the mitochondrial carrier family (SLC25), which is the largest solute carrier family in eukaryotes. Similar to its homologs in other organisms, ancA functions within the alternating access transport mechanism, cycling between cytoplasmic-open and matrix-open states to facilitate adenine nucleotide exchange .

The protein contains characteristic features of mitochondrial carrier proteins including:

FeatureDescription
StructureContains three repeating domains with two transmembrane α-helices
Substrate BindingPossesses positively charged residues that interact with the phosphate groups of ADP/ATP
Transport MechanismEmploys an alternating-access mechanism to translocate substrates
RegulationActivity can be modulated by membrane potential and substrate availability

This carrier function is electrogenic and reversible in nature, allowing for precise control of adenine nucleotide transport based on cellular energy demands .

What expression systems are used for producing recombinant Dictyostelium discoideum ancA protein?

Recombinant ancA protein can be successfully expressed in several systems, with E. coli being the most commonly employed for initial characterization studies. When expressing in E. coli, the following methodology yields optimal results:

  • Clone the full-length ancA gene (1-309 amino acids) into an expression vector containing an N-terminal His-tag for purification purposes

  • Transform into an E. coli expression strain optimized for membrane protein expression (e.g., C41(DE3) or C43(DE3))

  • Induce expression at lower temperatures (16-20°C) to reduce inclusion body formation

  • Include glycerol or detergents during purification to maintain protein stability

For studies requiring post-translational modifications or proper membrane insertion, eukaryotic expression systems like Saccharomyces cerevisiae or insect cells may provide better functional yields, though with increased complexity and cost.

What are the optimal storage conditions for recombinant ancA protein?

To maintain the structural integrity and activity of purified recombinant ancA protein, follow these evidence-based storage protocols:

  • Short-term storage (up to one week): Store at 4°C in Tris/PBS-based buffer (pH 8.0)

  • Long-term storage: Add 5-50% glycerol (final concentration) and store at -20°C/-80°C in small aliquots to avoid repeated freeze-thaw cycles

  • For maximum stability, lyophilized powder formulations can be reconstituted in sterile deionized water to a concentration of 0.1-1.0 mg/mL just before use

  • The addition of trehalose (6%) in the storage buffer enhances protein stability during freeze-thaw cycles

Research indicates that repeated freeze-thaw cycles significantly reduce protein activity, making single-use aliquots essential for consistent experimental results.

How can researchers accurately measure the transport activity of recombinant ancA protein?

Measuring the transport activity of ancA requires reconstitution into a membrane system that recapitulates its native environment. A robust methodology includes:

  • Reconstitute purified ancA into liposomes composed of a mixture of phosphatidylcholine and cardiolipin (4:1 ratio)

  • Prepare liposomes with internal substrate (typically ATP)

  • Measure transport by adding radiolabeled substrate ([³H]ADP or [¹⁴C]ADP) to the external medium

  • At defined time points, terminate transport using inhibitors (e.g., carboxyatractyloside or bongkrekic acid)

  • Separate liposomes from external medium by rapid filtration or size-exclusion chromatography

  • Quantify internalized radiolabeled substrate using liquid scintillation counting

For studying the electrogenic nature of transport, patch-clamp techniques on reconstituted proteoliposomes or membrane potential-sensitive dyes can provide complementary data on the electrical currents generated during substrate transport .

What is the relationship between ancA function and cAMP signaling in Dictyostelium discoideum?

The relationship between ancA-mediated energy metabolism and cAMP signaling reveals important regulatory mechanisms in Dictyostelium discoideum development:

  • During the transition from vegetative growth to development, Dictyostelium cells undergo dramatic changes in gene expression and energy metabolism triggered by starvation

  • cAMP acts as a secondary messenger in this process, coordinating cell aggregation and differentiation

  • The export of ATP via ancA is essential for maintaining cytosolic ATP levels required for cAMP production by adenylyl cyclase

  • Proteomic and transcriptomic analyses have identified ancA as one of the proteins upregulated during early development in response to cAMP pulses

  • Inhibition of ancA function impairs the cells' ability to produce and respond to cAMP signals, affecting chemotaxis and development

This interplay between energy metabolism and signaling highlights the integration of metabolic and developmental pathways in this model organism.

How does ancA activity influence mitochondrial dynamics in Dictyostelium discoideum?

ancA protein plays a central role in mitochondrial dynamics through its influence on energy-dependent processes:

  • Mitochondrial fusion and fission events are ATP-dependent processes that require adequate nucleotide exchange across the mitochondrial membrane

  • Research indicates that ancA interacts with dynamin superfamily proteins (DSPs), which are large GTPases involved in membrane fission and fusion events

  • Alterations in ancA activity affect mitochondrial morphology, with decreased activity typically resulting in fragmented mitochondria

  • The spatial distribution of mitochondria during chemotaxis and cell migration is dependent on proper ancA function

  • During developmental transitions, changes in ancA expression correlate with remodeling of the mitochondrial network

These findings suggest ancA serves not only as a passive transporter but also as an active participant in regulating mitochondrial dynamics and distribution during cellular processes.

What are the key structural features of ancA protein that determine substrate specificity?

The substrate binding site of ancA contains specific residues that determine its preference for adenine nucleotides:

  • X-ray crystallography and molecular modeling studies of mitochondrial carrier proteins reveal that substrate specificity is determined by:

    • Three positively charged residues (typically lysine or arginine) that interact with the phosphate groups of ADP/ATP

    • A set of aliphatic and aromatic residues that form a hydrophobic pocket accommodating the adenine moiety

    • Two pairs of asparagine/arginine residues on opposite sides of the binding site that participate in substrate binding in a state-dependent manner

  • The translocation pathway contains solvent-exposed residues that guide the substrate through a series of binding poses during transport

  • Sequence analysis of the ancA protein (amino acids 1-309) reveals conserved motifs characteristic of the mitochondrial carrier family that form the substrate binding site

This structural arrangement explains the electrogenic and reversible nature of adenine nucleotide transport mediated by ancA.

What methods are most effective for analyzing the structure-function relationship of ancA protein?

To elucidate structure-function relationships in ancA, researchers should employ a multi-technique approach:

  • Site-directed mutagenesis of key residues in the substrate binding site, followed by functional assays to measure transport activity

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify dynamic regions and conformational changes associated with substrate binding

  • Cryo-electron microscopy to determine the structure in different conformational states

  • Molecular dynamics simulations to model the transport mechanism and substrate interactions

  • Cross-linking mass spectrometry to identify residue pairs in close proximity during different stages of the transport cycle

  • Electrophysiological measurements to correlate structural changes with transport activity

This integrated approach provides complementary data on how structural elements contribute to the transport mechanism .

How can recombinant ancA be utilized to study host-pathogen interactions in Dictyostelium discoideum?

Recombinant ancA protein serves as a valuable tool for investigating host-pathogen interactions:

  • Dictyostelium discoideum is an established model for studying interactions with intracellular bacterial pathogens like Legionella pneumophila and Mycobacterium species

  • For such studies, researchers can:

    • Generate fluorescently-tagged ancA constructs to visualize mitochondrial dynamics during infection

    • Create ancA-depleted or overexpressing Dictyostelium cell lines to examine the impact on pathogen survival

    • Use purified recombinant ancA to identify bacterial effector proteins that may target mitochondrial transport

    • Investigate how bacterial pathogens manipulate host energy metabolism by affecting ancA function

  • These approaches have revealed that some bacterial pathogens secrete effector proteins that specifically target mitochondrial carriers to modulate host cell metabolism and survival

This application highlights the broader utility of ancA as a research tool beyond basic characterization studies.

What are the best approaches for studying ancA in the context of Dictyostelium discoideum development?

To investigate ancA's role in development, researchers should consider these methodological approaches:

  • Temporal expression analysis:

    • Use quantitative PCR and Western blotting to profile ancA expression during different developmental stages

    • Correlate expression with developmental markers and mitochondrial remodeling events

  • Genetic manipulation strategies:

    • Generate knockout or knockdown Dictyostelium strains using CRISPR-Cas9 or RNA interference

    • Create conditional expression systems to modulate ancA levels at specific developmental stages

    • Introduce point mutations in key functional residues to create transport-deficient variants

  • Live cell imaging:

    • Employ fluorescently-tagged ancA to track mitochondrial dynamics during development

    • Use fluorescence recovery after photobleaching (FRAP) to measure ancA mobility in the mitochondrial membrane

  • Metabolic profiling:

    • Measure ATP/ADP ratios in different cellular compartments during development

    • Correlate energy state with developmental progression and cAMP signaling

These approaches provide complementary data on how ancA function integrates with developmental processes.

How does ancA compare functionally with other ADP/ATP carriers across different species?

Comparative analysis reveals both conservation and divergence in ADP/ATP carrier properties:

SpeciesProteinIdentity with ancA (%)Key Functional Differences
HumanANT1-4~45-50%Tissue-specific isoforms with varying regulation
Yeast (S. cerevisiae)AAC1-3~55-60%Different responses to inhibitors
PlantsAAC~40-45%Additional regulatory mechanisms
D. discoideumancA100%Adapted to high A+T content genome environment

Functional differences include:

  • Substrate affinity variations, with ancA showing adaptations that may relate to the energy demands of Dictyostelium's unique life cycle

  • Different sensitivity to inhibitors like atractyloside and bongkrekic acid

  • Varied regulation by calcium and other signaling molecules

  • Species-specific protein-protein interactions

These comparative analyses provide insights into the evolutionary adaptations of mitochondrial carriers across species.

How can ancA research inform our understanding of human mitochondrial carrier-related diseases?

Research on ancA provides valuable insights for human disease models:

  • Mutations in human ADP/ATP carriers cause diseases including cardiomyopathy, myopathy, and certain neurodegenerative conditions

  • Dictyostelium discoideum serves as a non-mammalian model for studying these diseases because:

    • The conserved functional mechanisms between ancA and human carriers allow for parallel studies

    • The haploid nature of Dictyostelium simplifies genetic manipulation

    • The organism's rapid growth and development facilitate high-throughput screening

    • Its ability to transition between unicellular and multicellular states enables studies of tissue-specific effects

  • Methodological approaches include:

    • Introducing human disease-associated mutations into the corresponding residues of ancA

    • Assessing the impact on mitochondrial function, energy metabolism, and cell viability

    • Using complementation studies to test if human carriers can functionally replace ancA in Dictyostelium

    • Screening for small molecules that restore function to mutant carriers

These studies provide proof-of-concept for therapeutic strategies and enhance our understanding of mitochondrial carrier diseases.

What are the most reliable methods for detecting and quantifying ancA protein in Dictyostelium discoideum samples?

For accurate detection and quantification of ancA, researchers should consider these validated methods:

  • Western blotting:

    • Use antibodies against the ancA protein or against epitope tags (e.g., His-tag) for recombinant versions

    • Include proper controls (e.g., mitochondrial loading controls like porin)

    • For quantification, use standard curves with purified recombinant ancA protein

  • Mass spectrometry:

    • Employ targeted proteomics approaches such as selected reaction monitoring (SRM) or parallel reaction monitoring (PRM)

    • Use stable isotope-labeled internal standards for absolute quantification

    • The peptide sequence GIVDCFVR has been identified as a reliable ancA-specific marker peptide

  • Immunofluorescence microscopy:

    • Utilize specific antibodies or fluorescently-tagged versions for localization studies

    • Co-stain with mitochondrial markers to confirm proper localization

    • Use quantitative image analysis to measure expression levels in different cell types or developmental stages

These complementary approaches provide comprehensive data on ancA expression, localization, and abundance in different experimental contexts.

What considerations should be made when designing experiments to study ancA in the context of Dictyostelium's high A+T genome content?

The high A+T content (77.5% nuclear and 72.65% mitochondrial) of Dictyostelium discoideum genomes presents unique experimental challenges:

  • When designing primers for PCR amplification of ancA:

    • Increase primer length (25-30 nucleotides) to ensure specificity

    • Carefully check for potential off-target binding sites

    • Consider using GC-rich clamps at primer ends to improve annealing

  • For heterologous expression:

    • Optimize codon usage for the expression host while maintaining key structural elements

    • Be aware that direct gene synthesis may be preferable to PCR amplification from genomic DNA

  • When designing genome editing strategies:

    • CRISPR guide RNA design requires special attention to ensure specificity in the A+T-rich background

    • Alternative strategies like homologous recombination may be more reliable for certain applications

  • For transcriptomic analyses:

    • Account for potential bias in RNA-seq data analysis pipelines due to the unusual nucleotide composition

    • Validate findings with targeted approaches like qPCR

These considerations ensure robust experimental designs that account for the unique genomic characteristics of Dictyostelium discoideum.

What are the most promising future research directions for ancA protein studies?

The study of Dictyostelium discoideum ancA protein continues to offer significant opportunities for advancing our understanding of cellular energetics and mitochondrial biology:

  • Integration of ancA function with cellular signaling networks:

    • Exploring how ancA activity is regulated by development-specific signals

    • Investigating the role of post-translational modifications in modulating ancA function

    • Mapping the interactome of ancA to identify novel regulatory partners

  • Applications in synthetic biology:

    • Engineering ancA variants with altered substrate specificity or regulatory properties

    • Developing ancA-based biosensors for monitoring mitochondrial ADP/ATP exchange in real-time

    • Creating minimal synthetic systems for studying membrane transport mechanisms

  • Translational research:

    • Using ancA as a platform for understanding human mitochondrial diseases

    • Developing high-throughput screening approaches in Dictyostelium to identify compounds that modify carrier function

    • Exploring the potential of ancA inhibitors as tools for manipulating Dictyostelium development

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.