Recombinant Dictyostelium discoideum Mitochondrial substrate carrier family protein H (mcfH)

Shipped with Ice Packs
In Stock

Description

Functional Insights

MCF proteins mediate the transport of metabolites, ions, and nucleotides across mitochondrial membranes. For mcfH:

  • Substrate Specificity: Predicted to transport nucleotides or amino acids based on conserved binding motifs (e.g., glycine-rich regions) .

  • Calcium Regulation: Unique among MCF members, mcfH possesses N-terminal EF-hand motifs, suggesting Ca²⁺-dependent transport modulation .

  • Evolutionary Context: Phylogenetic analysis clusters mcfH with metazoan ADP/ATP carriers, indicating conserved roles in energy metabolism .

Expression and Purification

  • Expression System: Optimized in E. coli for high yield (~1.0 mg/mL post-reconstitution) .

  • Reconstitution: Requires addition of 50% glycerol for long-term stability .

Research Applications

  • Mechanistic Studies: Used to probe substrate selectivity and transport kinetics via liposome-based assays .

  • Disease Models: Potential relevance in mitochondrial disorders linked to SLC25 mutations (e.g., metabolic myopathies) .

Evolutionary and Comparative Analysis

  • Gene Expansion: Dictyostelium MCF genes, including mcfH, underwent duplication events paralleling metazoan evolution, enhancing substrate specialization .

  • Structural Conservation: Aligns with human SLC25A3 in transmembrane domains but diverges in regulatory regions (e.g., EF-hand motifs absent in humans) .

Future Directions

  • Substrate Identification: Functional assays (e.g., radiolabeled transport studies) are needed to validate predicted substrates like ADP/ATP .

  • Structural Resolution: Cryo-EM could elucidate conformational changes during Ca²⁺ binding or substrate translocation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your requests whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have specific tag requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
mcfH; slc25a40; DDB_G0275985; Mitochondrial substrate carrier family protein H; Solute carrier family 25 member 40 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-366
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
mcfH
Target Protein Sequence
MLSNSVNNNNNNNNINNSNSNNNDSNIHKNVKKLMVASIFGGIMSSLIVTPLDVVKTRLQ TQNTGSHINQKHVFKGTLDAFKKIYKNEGPLTFWRGVTPSLLMTIPSATIYFTSYEYLKE YLYQFNDTEAYNIYTVPLVAGTLARIFSASVTSPFELLRTNSQGIVLQNAYKNTVAMAAS SSTATIGTIPLSSEQRFNSFKLYRDIVNNVGIKGLWRGLGPTLVRDVPFSAIYWAGYEVL KNKLMKSQIDPNFSRNSKSPFFINFIAGATSGTLAAVLTTPIDVIKTRIQMSAQQTLSPS LTPQQQLDFIKKNNSSIYHLKQILSQEGWKGLTKGLVPRVAKVSPACAIMISTFEYIKQS HIADDN
Uniprot No.

Target Background

Function
Mitochondrial solute carriers facilitate the transport of metabolites, nucleotides, and cofactors across the mitochondrial inner membrane.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the Mitochondrial Substrate Carrier Family Protein H (mcfH) in Dictyostelium discoideum?

The mitochondrial substrate carrier family protein H (mcfH) is one of the 31 members of the mitochondrial carrier family (MCF) identified in Dictyostelium discoideum. Like other MCF proteins, mcfH is a membrane protein that mediates the transport of metabolites and cofactors across the inner mitochondrial membrane. It possesses the characteristic structure of MCF proteins with three repeated domains of approximately 100 amino acid residues each . The precise substrate specificity of mcfH may be determined through sequence comparison with biochemically characterized orthologs in other organisms and through analysis of conserved amino acid residues in the substrate binding sites.

How is mcfH structurally organized and what are its key domains?

The mcfH protein, like other members of the mitochondrial carrier family in D. discoideum, contains three characteristic repeated domains of approximately 100 amino acid residues. Some MCF proteins in Dictyostelium have supplementary structural domains consisting of Ca²⁺-binding motifs made up of EF-hand units localized on the N-terminal end, which face the mitochondrial intermembrane space . The specific structural organization of mcfH would need to be determined through sequence analysis and structural prediction tools to identify whether it possesses these additional Ca²⁺-binding domains or other unique structural features that distinguish it from other MCF proteins.

What is the predicted substrate specificity of mcfH based on sequence homology?

The substrate specificity of mcfH can be predicted based on sequence comparison with orthologs characterized biochemically in other organisms, phylogenetic analysis, and conservation of discriminating amino acid residues in substrate binding sites. Mitochondrial carrier proteins in Dictyostelium have been grouped into subclasses based on their specificity for transporting nucleotides, amino acids, or keto acids . Detailed sequence analysis and comparison with functionally characterized MCF proteins would be required to determine which subclass mcfH belongs to and predict its likely substrates.

What are the optimal conditions for recombinant expression of Dictyostelium mcfH?

For recombinant expression of Dictyostelium mcfH, researchers should consider several expression systems including bacterial (E. coli), yeast (P. pastoris), insect cells, or mammalian cells. The optimal expression system would depend on factors such as required post-translational modifications and protein folding requirements. For membrane proteins like mcfH, eukaryotic expression systems often provide better results due to their capacity for proper folding and membrane insertion.

A typical expression protocol would involve:

  • Codon optimization of the mcfH gene for the selected expression host

  • Cloning into an appropriate expression vector with affinity tags (His-tag or GST-tag)

  • Transformation/transfection of the host cells

  • Optimization of expression conditions (temperature, induction time, inducer concentration)

  • Scale-up of culture conditions

Expression should be verified by Western blotting using antibodies against the affinity tag or against mcfH itself if available .

What purification strategy is most effective for obtaining functional recombinant mcfH?

Purification of recombinant mcfH requires specialized approaches due to its membrane protein nature:

  • Cell lysis should be performed using gentle detergents that maintain protein structure and function.

  • Membrane fraction isolation through differential centrifugation.

  • Solubilization of membrane proteins using appropriate detergents (e.g., DDM, LDAO, or Fos-choline).

  • Affinity chromatography using the engineered tag.

  • Size exclusion chromatography to remove aggregates and obtain homogeneous protein.

  • Detergent exchange or reconstitution into liposomes or nanodiscs for functional studies.

Quality control should include SDS-PAGE, Western blotting, and circular dichroism to verify protein purity, identity, and proper folding. Functional assays should be performed to confirm that the purified protein retains transport activity.

How can I develop specific antibodies against mcfH for research applications?

Development of specific antibodies against mcfH can follow strategies similar to those used for other Dictyostelium proteins. Based on the recombinant antibody development approaches described for Dictyostelium antigens , two main methods can be employed:

  • Hybridoma sequencing approach:

    • Immunize mice with purified recombinant mcfH or synthetic peptides from unique regions

    • Generate hybridoma cell lines

    • Screen for specific antibody production

    • Sequence the hybridoma to obtain the antibody variable regions

    • Convert to recombinant antibody format (scFv-Fc)

  • Phage display technique:

    • Select target peptides or protein domains unique to mcfH

    • Perform phage display selection against these targets

    • Express and characterize the selected antibodies

    • Convert to appropriate format (scFv-Fc)

The antibodies should be rigorously validated through ELISA, Western blotting, immunofluorescence, and immunoprecipitation to ensure specificity for mcfH . Cross-reactivity with other MCF family members should be carefully evaluated due to sequence similarity among family members.

What transport assays can be used to determine the substrate specificity of mcfH?

To determine the substrate specificity of mcfH, several transport assays can be employed:

  • Liposome reconstitution assay:

    • Reconstitute purified mcfH into liposomes

    • Load liposomes with potential substrate or substrate analog

    • Measure substrate uptake or efflux using radioactive or fluorescent substrates

    • Compare transport rates for different substrates to determine specificity

  • Proteoliposome counter-exchange assay:

    • Load proteoliposomes with a substrate

    • Initiate transport by adding external substrate (potentially labeled)

    • Monitor exchange rates to determine substrate preference

  • Membrane potential-sensitive assays:

    • Since MCF proteins often transport charged molecules, measure changes in membrane potential during transport using voltage-sensitive dyes

  • Yeast complementation assays:

    • Express mcfH in yeast strains deficient in specific mitochondrial carriers

    • Assess functional complementation based on growth phenotypes

    • This can help identify the substrate class (nucleotides, amino acids, keto acids) that mcfH transports

Results should be analyzed quantitatively to determine transport kinetics (Km, Vmax) for various substrates, allowing for comparison with other characterized MCF proteins.

How can the subcellular localization of mcfH be confirmed in Dictyostelium cells?

Confirming the subcellular localization of mcfH in Dictyostelium cells can be accomplished through several complementary approaches:

  • Immunofluorescence microscopy:

    • Fix and permeabilize Dictyostelium cells following established protocols

    • Incubate with anti-mcfH antibodies (if available) or use epitope-tagged versions

    • Co-stain with established mitochondrial markers

    • Image using confocal microscopy to assess colocalization

    A typical protocol would include:

    • Allowing 5 × 10^5 D. discoideum cells to settle on glass coverslips

    • Fixing with 4% paraformaldehyde

    • Permeabilizing with cold methanol

    • Blocking with PBS + 0.2% BSA

    • Incubating with primary antibodies

    • Washing and incubating with fluorescent secondary antibodies

    • Mounting and imaging by confocal microscopy

  • Subcellular fractionation:

    • Disrupt Dictyostelium cells using gentle lysis conditions

    • Separate organelles through differential centrifugation

    • Analyze fractions by Western blotting with anti-mcfH antibodies

    • Compare against markers for mitochondria, peroxisomes, and other organelles

  • Fluorescent protein fusion approach:

    • Create mcfH-GFP fusion constructs

    • Express in Dictyostelium cells

    • Visualize localization in live cells

    • Co-stain with mitochondrial dyes (e.g., MitoTracker)

Since some MCF proteins can localize to peroxisomes rather than mitochondria , careful colocalization studies with both mitochondrial and peroxisomal markers are essential to definitively establish the subcellular location of mcfH.

What approaches can be used to identify interaction partners of mcfH?

Identifying protein-protein interactions involving mcfH can provide insights into its regulation and functional context. Several approaches can be applied:

  • Co-immunoprecipitation (Co-IP):

    • Generate cell lysates under conditions that preserve protein-protein interactions

    • Immunoprecipitate mcfH using specific antibodies

    • Identify co-precipitating proteins by mass spectrometry

    • Validate interactions by reverse Co-IP and Western blotting

  • Proximity labeling techniques:

    • Create fusions of mcfH with BioID or APEX2 enzymes

    • Express in Dictyostelium cells

    • Add biotin for labeling of proximal proteins

    • Purify biotinylated proteins and identify by mass spectrometry

  • Yeast two-hybrid screening:

    • Use specific domains of mcfH as bait

    • Screen against Dictyostelium cDNA library

    • Validate positive interactions with alternative methods

  • Cross-linking mass spectrometry:

    • Apply protein cross-linkers to intact cells or purified mitochondria

    • Purify mcfH complexes

    • Perform mass spectrometry analysis to identify cross-linked peptides

    • Map interaction interfaces

What strategies are available for generating mcfH knockout or knockdown strains in Dictyostelium?

Several genetic manipulation approaches can be used to generate mcfH knockout or knockdown strains in Dictyostelium:

  • Homologous recombination-based knockout:

    • Design targeting construct with selection marker flanked by mcfH homology arms

    • Transform Dictyostelium cells

    • Select transformants and verify gene disruption by PCR and Southern blotting

    • Confirm absence of protein expression by Western blotting

  • CRISPR-Cas9 mediated gene editing:

    • Design guide RNAs targeting mcfH

    • Optimize CRISPR-Cas9 delivery for Dictyostelium

    • Screen clones for mutations and validate knockout

    • This approach can generate clean deletions without selection markers

  • RNA interference (RNAi):

    • Design hairpin or antisense constructs targeting mcfH mRNA

    • Express from inducible promoters

    • Validate knockdown efficiency by qRT-PCR and Western blotting

    • This approach allows for conditional knockdown if complete knockout is lethal

  • Antisense RNA approach:

    • Express antisense RNA complementary to mcfH mRNA

    • This can achieve partial knockdown if complete loss is detrimental

For all approaches, phenotypic characterization should include growth rate assessment, morphological analysis, and specific assays relevant to mitochondrial carrier function such as mitochondrial membrane potential and respiration measurements.

How can the physiological role of mcfH be assessed through phenotypic analysis of knockout strains?

Comprehensive phenotypic analysis of mcfH knockout strains can reveal its physiological roles through several approaches:

  • Growth and development assessment:

    • Monitor growth rates in axenic medium and on bacterial lawns

    • Assess developmental timing and morphology during multicellular development

    • Test growth under different carbon and nitrogen sources to identify metabolic dependencies

  • Mitochondrial function assays:

    • Measure oxygen consumption using respirometry

    • Assess mitochondrial membrane potential using fluorescent dyes

    • Quantify ATP production under various conditions

    • Evaluate reactive oxygen species (ROS) production

  • Metabolic profiling:

    • Perform targeted metabolomics to measure levels of potential mcfH substrates

    • Compare metabolite profiles between wild-type and knockout strains

    • Look for accumulation of substrates or depletion of products

  • Stress response analysis:

    • Test susceptibility to oxidative stress, energy stress, or other stressors

    • Evaluate mitochondrial morphology under stress conditions

    • Assess calcium homeostasis if mcfH contains Ca²⁺-binding domains

  • Host-pathogen interaction studies:

    • If applicable, assess the ability of knockout strains to support bacterial growth

    • Evaluate phagocytosis efficiency, as Dictyostelium is a model for this process

The phenotypic data should be integrated to develop a comprehensive model of mcfH function, considering potential redundancy with other MCF family members in Dictyostelium.

What complementation strategies can verify the specificity of mcfH knockout phenotypes?

To verify that observed phenotypes are specifically due to mcfH deletion and not off-target effects, several complementation strategies can be employed:

  • Homologous gene re-expression:

    • Create expression constructs with wild-type mcfH under control of its native promoter

    • Introduce into knockout strains

    • Verify expression levels similar to endogenous levels

    • Assess rescue of knockout phenotypes

  • Inducible expression system:

    • Place mcfH under control of an inducible promoter

    • Enable dose-dependent expression

    • Correlate phenotypic rescue with expression levels

    • This can help determine threshold levels needed for function

  • Structure-function analysis through complementation:

    • Create mutant versions of mcfH with specific alterations in functional domains

    • Assess their ability to rescue knockout phenotypes

    • This can map critical residues for mcfH function

    • Focus on conserved substrate-binding residues identified through sequence analysis

  • Heterologous complementation:

    • Express orthologs from other species in the mcfH knockout

    • Assess degree of functional conservation

    • This can provide evolutionary insights into mcfH function

For all complementation experiments, appropriate controls should include empty vector transformants and expression of unrelated proteins to rule out non-specific effects of transformation or protein overexpression.

How can structural studies of mcfH inform its transport mechanism?

Structural studies of mcfH can provide crucial insights into its transport mechanism through several approaches:

  • X-ray crystallography:

    • Purify mcfH to high homogeneity

    • Identify optimal detergent or lipid environment for crystallization

    • Screen crystallization conditions

    • Solve structure at high resolution

    • This can reveal substrate binding sites and conformational states

  • Cryo-electron microscopy:

    • Prepare mcfH in detergent micelles, nanodiscs, or amphipols

    • Collect high-resolution images

    • Perform 3D reconstruction

    • This approach has revolutionized membrane protein structural biology

  • Molecular dynamics simulations:

    • Use solved or homology-modeled structures

    • Simulate protein dynamics in membrane environment

    • Study conformational changes during transport cycle

    • Test effects of mutations on stability and dynamics

  • Site-directed mutagenesis combined with functional assays:

    • Based on structural insights, mutate key residues

    • Assess effects on transport activity

    • Create a structure-function map of mcfH

  • Hydrogen-deuterium exchange mass spectrometry:

    • Probe conformational dynamics in different states

    • Identify regions with altered solvent accessibility during transport

The mitochondrial carrier family typically exhibits a characteristic three-fold pseudosymmetry with a central translocation pathway . Structural studies can reveal how mcfH conforms to or deviates from this pattern and how its specific substrate preference is determined at the molecular level.

What is the evolutionary significance of mcfH within the mitochondrial carrier family across species?

Understanding the evolutionary significance of mcfH requires comparative genomic and phylogenetic analyses:

  • Phylogenetic analysis:

    • Collect mcfH homologs across diverse species

    • Perform multiple sequence alignment

    • Construct phylogenetic trees

    • Identify orthologous relationships

    • Map gene duplication and loss events

  • Evolutionary rate analysis:

    • Calculate selection pressures (dN/dS ratios)

    • Identify conserved vs. rapidly evolving regions

    • This can highlight functionally critical domains

  • Comparative functional studies:

    • Express mcfH orthologs from different species in Dictyostelium knockout strains

    • Assess functional conservation

    • Correlate sequence divergence with functional differences

  • Analysis of mcfH in the context of Dictyostelium's unique evolutionary position:

    • As a social amoeba, Dictyostelium represents a unique evolutionary branch

    • Comparison with other MCF proteins in Dictyostelium (31 total members identified)

    • Evaluation of specialized functions that may have evolved in this lineage

The presence of calcium-binding domains in some Dictyostelium MCF proteins represents an interesting evolutionary adaptation that could be investigated specifically in relation to mcfH, determining whether such domains are present and what functional significance they might have.

How might mcfH function be integrated into broader mitochondrial physiology networks?

To understand how mcfH functions within broader mitochondrial physiology:

  • Systems biology approach:

    • Integrate transcriptomic, proteomic, and metabolomic data

    • Construct network models of mitochondrial function

    • Identify regulatory hubs and metabolic control points

    • Place mcfH within these networks

  • Multi-omics analysis of mcfH knockout strains:

    • Perform RNA-Seq, proteomics, and metabolomics

    • Identify compensatory changes in other transporters or metabolic pathways

    • Map ripple effects of mcfH deletion throughout cellular metabolism

  • Flux analysis:

    • Use stable isotope labeling to trace metabolic fluxes

    • Compare wild-type and mcfH knockout strains

    • Identify alterations in metabolic pathway usage

    • This can reveal the specific metabolic processes dependent on mcfH

  • Integration with calcium signaling (if applicable):

    • If mcfH contains calcium-binding domains , investigate its role in calcium-dependent regulation of mitochondrial function

    • Analyze interaction with other calcium-handling proteins

    • Study effects of calcium fluctuations on mcfH activity

  • Role in mitochondrial dynamics:

    • Assess effects of mcfH deletion on mitochondrial morphology

    • Investigate potential interactions with mitochondrial fusion/fission machinery

    • Examine distribution of mitochondria in different cellular contexts

This integrative approach can place mcfH within the broader context of mitochondrial function and cellular metabolism in Dictyostelium, potentially revealing unexpected roles beyond simple metabolite transport.

How can solubility and stability issues with recombinant mcfH be addressed?

As a membrane protein, recombinant mcfH may present solubility and stability challenges that can be addressed through several strategies:

  • Optimization of detergent conditions:

    • Screen multiple detergent types (mild non-ionic, zwitterionic, steroid-based)

    • Test detergent mixtures and concentrations

    • Evaluate protein stability using techniques like size-exclusion chromatography and thermal shift assays

    • Consider amphipols or fluorinated surfactants for increased stability

  • Protein engineering approaches:

    • Removal of flexible regions that may promote aggregation

    • Introduction of stabilizing mutations based on homology models

    • Creation of fusion constructs with stability-enhancing partners

    • Consider thermostabilized variants through directed evolution

  • Lipid supplementation:

    • Add specific lipids during purification

    • Test lipid mixtures that mimic the mitochondrial inner membrane

    • Consider cardiolipin, which is often critical for mitochondrial carrier function

  • Alternative reconstitution systems:

    • Reconstitute into nanodiscs for a more native-like membrane environment

    • Use liposomes with defined lipid composition

    • Consider styrene-maleic acid lipid particles (SMALPs) for extraction with surrounding lipids

  • Buffer optimization:

    • Screen buffer components systematically

    • Test pH ranges, salt concentrations, and additives

    • Include glycerol or sucrose as stabilizing agents

    • Consider osmolytes like TMAO or proline

Rigorous quality control through techniques like circular dichroism, fluorescence spectroscopy, and activity assays should be performed to ensure that the protein maintains its native fold and function throughout the purification process.

What are common pitfalls in interpreting transport assays for mcfH and how can they be avoided?

Transport assays for mcfH may be subject to several experimental artifacts and interpretation challenges:

  • Background permeability issues:

    • Liposomes may have intrinsic permeability to some compounds

    • Control experiments with protein-free liposomes are essential

    • Monitor liposome integrity using trapped markers

  • Protein orientation in liposomes:

    • MCF proteins may insert in both orientations during reconstitution

    • Asymmetric transport may be masked by mixed orientations

    • Consider techniques to achieve uniform orientation or determine the ratio of orientations

  • Secondary transport phenomena:

    • Transport of one substrate may create gradients driving non-specific transport of others

    • Design experiments to distinguish direct from indirect effects

    • Use appropriate inhibitors to block specific transport pathways

  • Substrate purity concerns:

    • Commercial substrates may contain contaminants that are actually transported

    • Use highest purity substrates available

    • Consider synthesizing or purifying substrates when necessary

  • Distinguishing transport from binding:

    • Apparent substrate association may represent binding without transport

    • Design experiments with membrane-impermeant quenchers or indicators

    • Perform time-course measurements to distinguish binding kinetics from transport

  • Data interpretation guidance:

    • Use multiple substrate concentrations to determine kinetic parameters

    • Compare transport rates under various conditions (pH, membrane potential)

    • Consider competitive inhibition studies to map substrate specificity

    • Always include positive controls with known transporters

By addressing these potential pitfalls systematically, researchers can generate more reliable and interpretable data on mcfH transport activity and substrate specificity.

How can contradictory results between in vitro transport assays and in vivo phenotypes be reconciled?

Discrepancies between in vitro transport assays and in vivo phenotypes for mcfH may arise from several factors:

  • Physiological context differences:

    • In vitro systems lack the complete cellular environment

    • Consider reconstituting with Dictyostelium mitochondrial lipid extracts

    • Examine effects of pH, membrane potential, and ion gradients that exist in vivo

  • Regulatory mechanisms:

    • mcfH may be subject to post-translational modifications in vivo

    • Activity may depend on protein-protein interactions absent in vitro

    • Investigate phosphorylation, acetylation, or other modifications

    • If mcfH contains Ca²⁺-binding domains , calcium regulation may be crucial

  • Compensatory mechanisms:

    • Other transporters may compensate for mcfH deficiency in vivo

    • Perform combinatorial knockouts of related transporters

    • Analyze transcriptional responses to mcfH deletion

  • Substrate availability:

    • In vivo substrate concentrations may differ from those used in vitro

    • Metabolomics analysis of relevant metabolite pools can inform more physiological assay conditions

    • Consider compartmentation effects on local substrate concentrations

  • Experimental approach to reconciliation:

    • Use genetically encoded sensors to measure transport in intact cells

    • Isolate mitochondria from wild-type and mcfH knockout strains for comparative transport assays

    • Perform complementation with mutant versions to link specific transport activities to phenotypes

  • Systematic analysis framework:

    ApproachStrengthsLimitationsIntegration Strategy
    In vitro transportDirect measurement, controlled conditionsArtificial environmentUse to define biochemical parameters
    Knockout phenotypingPhysiological relevanceComplex interpretationMap broad functional roles
    MetabolomicsComprehensive view of metabolic impactDifficult to determine direct vs. indirect effectsIdentify candidate substrates and affected pathways
    ComplementationLinks genotype to phenotypeExpression level artifactsTest structure-function relationships

By integrating multiple approaches and carefully considering the limitations of each, researchers can develop a more comprehensive understanding of mcfH function that reconciles in vitro biochemistry with in vivo physiology.

What emerging technologies could advance our understanding of mcfH function?

Several cutting-edge technologies hold promise for advancing our understanding of mcfH:

  • Cryo-electron tomography:

    • Study mcfH in its native mitochondrial membrane environment

    • Visualize interactions with other complexes

    • Map distribution and organization within the mitochondrial inner membrane

  • Single-molecule techniques:

    • Apply single-molecule FRET to monitor conformational changes during transport

    • Use optical tweezers or atomic force microscopy to study mechanical properties

    • Perform single-molecule transport assays to detect heterogeneity in transport behavior

  • Genetically encoded biosensors:

    • Develop sensors for potential mcfH substrates

    • Target these sensors to mitochondria

    • Monitor transport activity in live cells

    • Correlate with physiological stimuli

  • Genome editing advances:

    • Apply base editing or prime editing for precise modification of mcfH

    • Create allelic series with graduated functional impacts

    • Introduce specific mutations corresponding to human disease variants in orthologous proteins

  • Proteomics approaches:

    • Apply proximity labeling specifically from mcfH

    • Use cross-linking mass spectrometry to map interaction interfaces

    • Apply thermal proteome profiling to identify ligand interactions

  • Artificial intelligence applications:

    • Use machine learning to predict substrate specificity from sequence

    • Apply structural prediction tools like AlphaFold to model mcfH structure

    • Develop systems biology models incorporating mcfH function

These emerging technologies can provide unprecedented insights into the structural dynamics, regulation, and physiological context of mcfH function, particularly when applied in complementary combinations.

How might studies of mcfH in Dictyostelium inform understanding of related human diseases?

Research on mcfH in Dictyostelium can provide valuable insights into human diseases related to mitochondrial carrier dysfunction:

  • Identification of conserved functional mechanisms:

    • Mitochondrial carriers are highly conserved across evolution

    • Fundamental transport mechanisms established in Dictyostelium likely apply to human orthologs

    • Substrate specificity determinants may be conserved

  • Disease modeling opportunities:

    • Introduce mutations corresponding to human disease variants

    • Assess functional consequences in a simpler system

    • Screen for suppressor mutations or chemical modifiers

  • Relevance to specific human disorders:

    • Several human diseases result from mutations in mitochondrial carrier family proteins

    • Examples include Amish microcephaly (SLC25A19), HHH syndrome (SLC25A15), and carnitine-acylcarnitine translocase deficiency (SLC25A20)

    • Study of mcfH may reveal general principles applicable across the family

  • Therapeutic development platforms:

    • Dictyostelium as a screening system for compounds that rescue transporter defects

    • Identification of bypass mechanisms that could be therapeutic targets

    • Development of transporter-specific inhibitors or activators

  • Comparative approach benefits:

    • Dictyostelium offers experimental advantages over mammalian systems

    • Haploid genome simplifies genetic manipulation

    • Faster growth and development cycle accelerates research

    • Cellular features like phagocytosis and chemotaxis can model specialized cell functions

By establishing fundamental principles of mitochondrial carrier function in Dictyostelium, researchers can create a foundation for understanding the more complex regulatory networks in human cells and the pathological consequences when these systems malfunction.

What potential biotechnological applications might arise from detailed characterization of mcfH?

Detailed characterization of mcfH could lead to several biotechnological applications:

  • Biosensor development:

    • Engineer mcfH variants as sensors for specific metabolites

    • Apply to metabolic engineering and fermentation monitoring

    • Develop diagnostic tools for metabolic disorders

  • Synthetic biology applications:

    • Use mcfH to create artificial metabolic compartments

    • Engineer metabolic pathways with controlled substrate access

    • Modify substrate specificity for novel transport functions

  • Drug discovery platforms:

    • Use purified mcfH in high-throughput screening assays

    • Identify inhibitors or modulators with therapeutic potential

    • Develop tools for manipulating mitochondrial metabolism

  • Production of challenging metabolites:

    • Exploit mcfH transport capability in metabolic engineering

    • Enhance production or secretion of valuable compounds

    • Address bottlenecks in metabolite transport between compartments

  • Protein engineering advances:

    • Develop improved methods for membrane protein production

    • Create stable variants for structural studies

    • Generate chimeric transporters with novel functions

  • Dictyostelium as a biotechnology platform:

    • Knowledge of mcfH contributes to broader understanding of Dictyostelium metabolism

    • May enable development of Dictyostelium as a protein production host

    • Could facilitate use of Dictyostelium for specific biotechnology applications

These applications represent potential long-term outcomes of fundamental research on mcfH structure and function, illustrating how basic science on model organisms can lead to practical biotechnological innovations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.