Recombinant Dictyostelium discoideum Mitochondrial substrate carrier family protein N (mcfN)

Shipped with Ice Packs
In Stock

Description

Introduction to Mitochondrial Carrier Family Proteins in Dictyostelium discoideum

Mitochondrial carrier family (MCF) proteins constitute a specialized group of membrane transport proteins that facilitate the movement of metabolites, nucleotides, and cofactors across the inner mitochondrial membrane. These carriers are essential for connecting metabolic pathways occurring in different cellular compartments, particularly between the cytosol and mitochondrial matrix. In Dictyostelium discoideum, a total of 31 MCF members have been identified through similarity searches, all possessing characteristic structural features typical of this protein family .

Dictyostelium discoideum, a social amoeba, serves as an important model organism for studying various cellular processes including mitochondrial transport mechanisms. The MCF proteins in D. discoideum have been categorized into subclasses based on their transport specificity for nucleotides, amino acids, or keto acids . The mcfN protein represents one specific member of this diverse family, with distinctive structural and functional properties that contribute to cellular metabolism in this organism.

Classification and Nomenclature of mcfN

The mitochondrial substrate carrier family protein N (mcfN) in Dictyostelium discoideum is also known by its systematic name as solute carrier family 25 member 3 homolog (SLC25A3) . This classification places mcfN within the broader SLC25 family of solute carriers that are widely distributed across eukaryotic organisms. The protein is encoded by the mcfN gene, which is identified in genomic databases under the accession UniProt ID Q54BF6 .

General Properties of Mitochondrial Carrier Proteins

Mitochondrial carriers share several common structural features, including a tripartite structure, a threefold repeated signature motif, and six transmembrane α-helices . These carriers are primarily located in the inner mitochondrial membrane, with a few exceptions found in peroxisomal membranes . The conserved structural elements of MCF proteins contribute to their ability to transport specific substrates across membranes, thereby fulfilling their critical roles in cellular metabolism.

Structure and Characteristics of mcfN

The mcfN protein exhibits structural features that are characteristic of the mitochondrial carrier family, including multiple transmembrane domains that span the inner mitochondrial membrane.

Conserved Domains and Motifs

Like other members of the mitochondrial carrier family, mcfN contains three tandem repeats of approximately 100 amino acid residues each, forming a characteristic three-domain structure . Each domain typically contains two transmembrane α-helices connected by a loop region. The protein likely contains the conserved signature motif PX[D/E]XX[K/R]X[K/R], which is characteristic of mitochondrial carrier proteins and is located in the conical pit region (CPR) . This motif plays a crucial role in substrate binding and transport mechanism.

Production and Characterization of Recombinant mcfN

The recombinant form of Dictyostelium discoideum mcfN protein offers significant advantages for studying the structural and functional properties of this mitochondrial carrier.

Expression and Purification

The recombinant full-length Dictyostelium discoideum mcfN protein is typically produced with an N-terminal His tag to facilitate purification. The protein is expressed in Escherichia coli expression systems, which provide an efficient platform for obtaining substantial quantities of the protein for biochemical and structural studies .

Physical and Chemical Properties

The recombinant mcfN protein is available in lyophilized powder form with a purity greater than 90% as determined by SDS-PAGE analysis . The protein contains an N-terminal His tag, which facilitates its purification using affinity chromatography methods. The product is typically stored in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 to maintain stability .

Functional Properties and Role in Cellular Metabolism

As a member of the mitochondrial carrier family, mcfN plays crucial roles in cellular metabolism by facilitating the transport of specific solutes across the inner mitochondrial membrane.

Transport Function and Substrate Specificity

Based on sequence homology with other characterized mitochondrial carrier proteins, mcfN likely functions as a phosphate carrier, specifically as a solute carrier family 25 member 3 homolog (SLC25A3) . The SLC25A3 proteins typically transport inorganic phosphate into the mitochondrial matrix, which is essential for oxidative phosphorylation and ATP synthesis .

The substrate binding site in the three even α-helices (TR246) of mcfN is highly conserved among eukaryotes, suggesting that the substrate specificity of this protein has been maintained throughout evolution . This conservation indicates the fundamental importance of phosphate transport in mitochondrial function across diverse eukaryotic lineages.

Role in Mitochondrial Energy Metabolism

As a putative phosphate carrier, mcfN likely plays a critical role in mitochondrial energy metabolism in Dictyostelium discoideum. The transport of inorganic phosphate into the mitochondrial matrix is essential for ATP synthesis via oxidative phosphorylation. Phosphate combines with ADP to form ATP during this process, making phosphate carriers vital components of cellular energy production mechanisms .

Integration with Cellular Metabolic Pathways

Mitochondrial carrier proteins, including mcfN, provide crucial links between metabolic reactions occurring in the cytosol and those in the mitochondrial matrix . By facilitating the transport of metabolites across the inner mitochondrial membrane, these carriers integrate various metabolic pathways such as oxidative phosphorylation, the citric acid cycle, fatty acid oxidation, and amino acid degradation .

Evolutionary Significance of mcfN

The evolutionary analysis of mitochondrial carrier proteins provides valuable insights into the relationships between different organisms and the conservation of essential cellular functions.

Conservation Among Eukaryotes

Phylogenetic analysis of mitochondrial carrier proteins shows that the substrate binding sites in these proteins are highly conserved across eukaryotes, indicating the fundamental importance of their transport functions . The conservation of these sites in mcfN suggests that its role in phosphate transport has been maintained throughout eukaryotic evolution.

Relationship Between Dictyostelids and Metazoans

Evolutionary analyses of mitochondrial carrier proteins reveal a close relationship between dictyostelids (including Dictyostelium discoideum) and metazoans in terms of their solute transport capabilities . This similarity is particularly evident in carriers related to ADP/ATP transport, where dictyostelids have undergone gene expansion similar to metazoans .

The transmembrane regions (TR) and conical pit regions (CPR) of mitochondrial carriers in dictyostelids show motifs similar to those of metazoan carriers, suggesting a close evolutionary relationship between these groups . This finding is significant as it indicates that dictyostelids have developed advanced solute transport capabilities that can support the energy needs associated with multicellularity .

Implications for Multicellularity

The advanced solute transport capabilities of dictyostelid mitochondrial carriers, including mcfN, may have contributed to the evolution of multicellular features in these organisms. Dictyostelium discoideum exhibits characteristics of true multicellularity, such as cell-cell signaling, cellular specialization, and coherent cell movement . The efficient transport of metabolites across mitochondrial membranes would support the increased energy demands associated with these complex cellular behaviors.

Applications and Future Research Directions

The recombinant Dictyostelium discoideum mcfN protein offers valuable opportunities for research in various fields, from basic mitochondrial biology to potential biotechnological applications.

Research Applications

Recombinant mcfN serves as an important tool for studying:

  1. Mitochondrial transport mechanisms: The protein can be used in biochemical assays to investigate the kinetics and specificity of phosphate transport across membranes.

  2. Structural biology: Purified recombinant mcfN can be used for crystallization studies to determine its three-dimensional structure, providing insights into the molecular mechanisms of substrate recognition and transport.

  3. Protein-protein interactions: The recombinant protein can be employed in interaction studies to identify potential binding partners and regulatory factors that modulate its activity.

Potential Therapeutic Relevance

Understanding the structure and function of mitochondrial carrier proteins like mcfN has implications for human health, as defects in these carriers are associated with various metabolic disorders. The knowledge gained from studying Dictyostelium discoideum mcfN can potentially inform research on human mitochondrial carrier deficiencies and associated diseases.

Future Research Directions

Several promising avenues for future research on mcfN include:

  1. Detailed characterization of its transport kinetics and substrate specificity using reconstituted proteoliposomes.

  2. Investigation of its regulation in response to different metabolic states and environmental conditions.

  3. Exploration of its interactions with other proteins and potential incorporation into larger complexes within the mitochondrial membrane.

  4. Comparison of its properties with orthologs from other species to gain insights into the evolution of mitochondrial transport functions.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request if possible.
Lead Time
Delivery times may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. We suggest storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
mcfN; slc25a3; DDB_G0293646; Mitochondrial substrate carrier family protein N; Solute carrier family 25 member 3 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-298
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
mcfN
Target Protein Sequence
MAGDLTPSLFLKYGFGGALSCSITHSLVVPLDVVKTLLQTNPGKYTGMMNGFSTVIKEQG PSGLLQGLGPTAVGYALQGFLKFGFYEVFKKTYADAVGEKADQFRIPIWLAASATAEVIA DIALCPNEAVRIRLVAEPTFAKSPVEAFGKIFKQEGVLGFYKGLPPILLKQVPYTMAKFA VFEFTAENVYKGLAASGKPKESLTDGQKLSVSLGSGIVAGIVAAIVSQPADTILSKINQE KTDGGVVKAIGNIMRRLGVRGLFLGLPTRCFMVGTLTAGQFFIYDGIKQMLGLTPAKK
Uniprot No.

Target Background

Function
Mitochondrial solute carriers facilitate the transport of metabolites, nucleotides, and cofactors across the mitochondrial inner membrane. This protein transports phosphate groups from the cytosol into the mitochondrial matrix. Phosphate is cotransported with H+.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is mcfN and why is it significant for research?

mcfN (Mitochondrial substrate carrier family protein N) is a 298-amino acid protein found in the social amoeba Dictyostelium discoideum. It belongs to the mitochondrial carrier family proteins that facilitate transport of metabolites across the mitochondrial inner membrane. This protein is significant because D. discoideum serves as a simplified model system for studying processes relevant to human mitochondrial function and diseases . The protein shares homology with human solute carrier family 25 member 3 (SLC25A3), making it valuable for comparative studies of mitochondrial transport mechanisms .

How does D. discoideum's genome facilitate mcfN research?

D. discoideum has been entirely sequenced, revealing many orthologs of human genes associated with various disorders, including those involved in mitochondrial function . This genetic tractability allows researchers to easily manipulate genes like mcfN and analyze phenotypic changes. The haploid nature of D. discoideum's genome further simplifies genetic manipulation and functional studies compared to diploid model organisms . This genetic accessibility makes it particularly valuable for studying the conserved functions of mitochondrial carrier proteins like mcfN .

What expression systems are optimal for producing recombinant mcfN?

Recombinant mcfN is typically expressed in E. coli expression systems with an N-terminal His-tag for purification purposes . For functional studies, the following approaches have proven successful:

  • Bacterial expression: E. coli systems provide high yields of recombinant protein but may require optimization of solubilization and refolding protocols due to the hydrophobic nature of membrane proteins .

  • Yeast expression: Alternative systems like Saccharomyces cerevisiae or Pichia pastoris may provide better folding for functional studies, especially when investigating transport activity.

  • Cell-free systems: These can be considered for proteins that are toxic to host cells or aggregate during expression .

The choice depends on whether structural studies, functional assays, or antibody production is the primary goal of recombinant mcfN production.

How can researchers effectively purify recombinant mcfN for functional studies?

The optimal purification strategy for recombinant mcfN involves:

  • Affinity chromatography: Using His-tag affinity purification as the initial step, with careful optimization of imidazole concentrations for binding and elution .

  • Buffer optimization: Working with detergent-containing buffers (typically mild non-ionic detergents) to maintain protein solubility without denaturing the carrier protein.

  • Secondary purification: Following with size-exclusion chromatography to enhance purity and remove aggregates.

  • Storage considerations: The purified protein should be stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0 to maintain stability. For long-term storage, adding glycerol (final concentration 50%) and storing at -20°C/-80°C in aliquots is recommended to avoid repeated freeze-thaw cycles .

What phenotypic assays can assess mcfN function in D. discoideum?

Several phenotypic assays can be used to investigate mcfN function:

  • Mitochondrial respiration measurements: Using oxygen consumption rate measurements to assess impact on mitochondrial function, similar to studies done with other mitochondrial proteins in D. discoideum .

  • Growth rate analysis: Comparing wild-type and mcfN knockout strains in various media conditions to assess metabolic impacts .

  • Development cycle observations: Monitoring the multicellular development of D. discoideum as mitochondrial defects often impact the developmental cycle .

  • Phototaxis and thermotaxis assays: These behavioral assays have been used successfully to identify mitochondrial dysfunction in D. discoideum expressing other proteins like α-synuclein .

  • Cell motility and chemotaxis: Assessing changes in movement patterns that might reflect altered energy metabolism .

How can CRISPR/Cas9 technology be applied to study mcfN function?

CRISPR/Cas9 technology has been successfully implemented in D. discoideum for gene modification. For studying mcfN:

  • Design process: Select sgRNA sequences using online tools like http://www.rgenome.net/cas-designer/ that target the mcfN gene .

  • Cloning procedure: Clone sgRNAs into appropriate vectors (e.g., pTM1285 plasmid) using Golden-gate assembly with BpiI enzyme before transformation into E. coli .

  • Transfection protocol: Electroporate D. discoideum cells with purified plasmid (approximately 20 μg for 16 × 10^6 cells) .

  • Selection process: Add selective antibiotics (e.g., G418 at 15 μg/ml) to isolate transfected cells, followed by limiting dilution cloning without antibiotics .

  • Validation methods: Confirm gene editing by PCR amplification and sequencing of the targeted genomic region .

This approach allows for precise knockout or modification of mcfN to study its functional role in mitochondrial transport and cellular metabolism.

How does mcfN relate to the broader D. discoideum mitochondrial proteome?

In a comprehensive analysis of the D. discoideum mitochondrial proteome, researchers identified approximately 616 proteins with homology to human mitochondrial proteins from MitoCarta 3.0 . This represents a smaller set compared to humans (1,136) and baker's yeast (901), suggesting proteome divergence or incomplete identification .

The mitochondrial carrier family, to which mcfN belongs, plays crucial roles in:

  • Maintaining metabolite homeostasis between cytosol and mitochondria

  • Supporting energy production and metabolic pathways

  • Enabling signaling processes involving mitochondria

To fully understand mcfN's role, proteomic approaches combining:

  • Bioinformatic homology analysis

  • Direct mitochondrial isolation and protein identification

  • Functional characterization of identified carriers

provide the most comprehensive picture of how mcfN fits within the mitochondrial transport network .

What are the implications of mcfN research for understanding human mitochondrial diseases?

Research on mcfN contributes to our understanding of human mitochondrial diseases in several ways:

  • Conserved mechanisms: Despite lacking a central nervous system, D. discoideum has highly conserved cellular processes related to mitochondrial function that provide insights into key cellular abnormalities associated with neurological disorders .

  • Model for SLC25 family disorders: As mcfN shows homology to human SLC25A3, studying its function may provide insights into conditions linked to this transporter, including mitochondrial phosphate carrier deficiency .

  • Drug screening platform: D. discoideum has proven valuable for elucidating mechanisms of action of therapeutic agents and screening novel compounds prior to validation in higher eukaryotes .

  • Simplified system for complex pathologies: The protein allows investigation of basic mitochondrial transport mechanisms without the complexity of mammalian systems, facilitating mechanistic studies of disease-associated processes .

The connection between mitochondrial dysfunction and neurological disorders makes mcfN research particularly relevant for conditions like Parkinson's, Alzheimer's, and other neurodegenerative diseases where mitochondrial transport is implicated .

What biochemical fractionation approaches are most effective for isolating native mcfN?

Effective biochemical fractionation of native mcfN from D. discoideum involves several steps:

  • Initial cell lysis: Prepare D. discoideum cleared cell lysates using appropriate lysis buffers maintained at specific pH conditions (such as pH 3 for anion exchange) .

  • Anion exchange chromatography: Mix lysate with anion exchange resin (e.g., Q Sepharose Fast Flow) pre-washed in lysis buffer at the appropriate pH. After incubation, collect both unbound and bound fractions .

  • Sequential elution: For higher resolution, elute bound proteins using increasing NaCl concentration gradients (from 50 to 500 mM with 50 mM increments) .

  • Size-exclusion chromatography: Further purify active fractions using SEC columns (e.g., Superdex 200) equilibrated and eluted with appropriate buffers at controlled flow rates .

  • Activity testing: Throughout fractionation, test fractions for preserved biological activity relevant to the protein's function .

This approach allows isolation of native mcfN while maintaining its functional properties for subsequent studies.

How can researchers effectively measure transport function of mcfN?

To measure the transport function of mcfN, researchers can employ several complementary approaches:

  • Liposome reconstitution assays: Reconstitute purified mcfN into liposomes and measure substrate transport across these artificial membranes using radiolabeled substrates or fluorescent probes.

  • Mitochondrial uptake experiments: Isolate mitochondria from wild-type and mcfN-deficient D. discoideum strains and compare their ability to uptake potential substrates.

  • Patch-clamp electrophysiology: For electrogenic transporters, use patch-clamp techniques on mitochondrial preparations or reconstituted systems to directly measure transport activity.

  • Yeast complementation studies: Express D. discoideum mcfN in yeast strains deficient in homologous transporters and assess functional rescue through growth assays under various metabolic conditions .

  • Metabolomic profiling: Compare metabolite profiles between wild-type and mcfN-mutant cells to identify accumulated or depleted metabolites that might represent substrates.

These methods provide complementary data on transport kinetics, substrate specificity, and physiological relevance of mcfN function.

What imaging techniques are most informative for studying mcfN localization and dynamics?

Several imaging techniques can provide valuable insights into mcfN localization and dynamics:

  • Fluorescent protein tagging: Create mcfN-GFP (or other fluorescent protein) fusions to visualize localization in living cells. This approach has been successfully used for other D. discoideum mitochondrial proteins .

  • Immunofluorescence microscopy: Use antibodies against the His-tag or the protein itself for fixed-cell imaging, which can provide higher specificity .

  • Super-resolution microscopy: Techniques like STED or PALM/STORM can resolve sub-mitochondrial localization of mcfN, potentially identifying specific domains within mitochondria.

  • Live-cell imaging: For studying dynamic processes, spinning disk confocal microscopy allows tracking of labeled mcfN in living cells with minimal phototoxicity.

  • Correlative light and electron microscopy (CLEM): Combines fluorescence imaging with the ultrastructural detail of electron microscopy to precisely localize mcfN within mitochondrial subcompartments.

  • FRAP (Fluorescence Recovery After Photobleaching): To study mobility and turnover rates of mcfN within mitochondrial membranes.

These techniques can reveal not just localization but also interactions with other mitochondrial components and responses to cellular stimuli or stressors.

What are the key challenges in studying mcfN function compared to other mitochondrial carriers?

Researchers face several challenges when studying mcfN:

  • Substrate identification: Determining the specific metabolites transported by mcfN remains challenging, as the endogenous substrates are yet to be identified even for better-studied mitochondrial carriers .

  • Functional redundancy: Potential overlap with other carrier proteins may mask phenotypes in knockout studies, requiring more sophisticated approaches like double or triple knockouts.

  • Protein stability: Mitochondrial carrier proteins are often difficult to express and purify in functional form due to their hydrophobic nature and complex folding requirements .

  • Technical limitations: Reconstitution of transport activity in artificial systems may not perfectly recapitulate the physiological environment of the mitochondrial inner membrane.

  • Evolutionary divergence: While useful as a model, differences between D. discoideum and human mitochondrial systems must be carefully considered when extrapolating findings .

How can comparative studies with human mitochondrial carriers enhance mcfN research?

Comparative studies between mcfN and human mitochondrial carriers offer several advantages:

  • Evolutionary insights: Analyzing conserved and divergent features can reveal core functional domains versus species-specific adaptations.

  • Functional prediction: Human carriers with established functions can suggest potential roles for mcfN through homology, particularly with SLC25A3 .

  • Disease relevance: Understanding how differences in carrier structure relate to function can inform research on human mitochondrial diseases.

  • Therapeutic applications: Comparative studies may identify druggable sites that are conserved across species, facilitating development of therapeutics targeting mitochondrial transport.

  • Biochemical diversity: Different species' carriers may exhibit distinct biochemical properties (substrate specificity, regulation, etc.) that broaden our understanding of transport mechanisms.

A systematic approach comparing sequence, structure, expression patterns, and function across species can significantly enhance the translational value of mcfN research.

What new technologies might advance mcfN research in the coming years?

Emerging technologies likely to impact mcfN research include:

  • Cryo-electron microscopy: Advanced structural determination of membrane proteins in near-native states, potentially revealing mechanistic details of transport .

  • AlphaFold and other AI protein structure prediction: Computational models may provide structural insights when experimental structures are unavailable.

  • Single-molecule techniques: Methods to study individual transporter molecules could reveal conformational changes during transport cycles.

  • Organoid and tissue-on-chip technologies: More complex cellular environments to study mcfN function in tissue-like contexts.

  • Metabolic flux analysis: Advanced metabolomics combined with stable isotope labeling to track substrate movement across membranes.

  • Optogenetics and chemogenetics: Tools to precisely control mcfN activity in living cells with temporal and spatial precision.

  • Multi-omics integration: Combining proteomics, metabolomics, and transcriptomics to understand mcfN's role in broader cellular networks.

These technologies promise to overcome current limitations and provide deeper insights into the structure, function, and regulation of mitochondrial carrier proteins like mcfN.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.