Recombinant Dictyostelium discoideum Mitochondrial substrate carrier family protein ucpA (ucpA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Dictyostelium discoideum Mitochondrial Substrate Carrier Family Protein ucpA (ucpA)

The recombinant Dictyostelium discoideum mitochondrial substrate carrier family protein ucpA (ucpA) is a protein derived from the social amoeba Dictyostelium discoideum. It belongs to the mitochondrial carrier family, which plays a crucial role in transporting various metabolites across the mitochondrial membrane. This protein is particularly interesting due to its involvement in mitochondrial function and its potential applications in biotechnology and biomedical research.

Characteristics of Recombinant ucpA Protein

The recombinant ucpA protein is produced in Escherichia coli and is available as a His-tagged, full-length protein consisting of 306 amino acids (1-306 aa) . The protein is provided in a lyophilized powder form with a purity of greater than 90% as determined by SDS-PAGE. It is stored in a Tris/PBS-based buffer with 6% trehalose at pH 8.0 and should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL for use .

Function and Pathways

The ucpA protein is part of the mitochondrial substrate carrier family, which is involved in the transport of various substrates across the mitochondrial membrane. These proteins are crucial for maintaining mitochondrial function and energy metabolism within cells. While specific pathways involving ucpA are not extensively detailed, proteins in this family generally facilitate the transport of metabolites, nucleotides, and other compounds essential for cellular metabolism .

Table 2: Potential Functions and Pathways

Function/PathwayDescription
Mitochondrial TransportTransport of metabolites and cofactors across the mitochondrial membrane.
Energy MetabolismPlays a role in maintaining mitochondrial function and energy balance within cells.

Research Findings and Applications

Research on ucpA and related proteins has shown their potential in improving microbial tolerance to certain stressors. For example, overexpression of a similar protein in Escherichia coli has been shown to enhance furfural tolerance, which is beneficial for biofuel production . Additionally, Dictyostelium discoideum itself has emerged as a promising model organism for studying various biological processes, including neurological disorders .

Table 3: Applications and Research Implications

Application/ImplicationDescription
Microbial Stress ToleranceOverexpression can enhance tolerance to furfural and other stressors in microbial systems.
Biomedical ResearchDictyostelium discoideum serves as a model organism for studying neurological disorders and other biological processes.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will prepare the product according to your needs.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on several factors, including storage conditions, buffer ingredients, storage temperature, and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ucpA; slc25a35; DDB_G0271310; Mitochondrial substrate carrier family protein ucpA; Solute carrier family 25 member 35 homolog; Uncoupler protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-306
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
ucpA
Target Protein Sequence
MSVNLNNNKNNKNKVAIGFISGSLASICATTVTNPIELVKTRLQLQGELQLSQRIYNGVW DAFKQIYKTEGIRGLQSGLIPAYFSQATMQGIRLGSFDLISNALGAKPNQDYFFLKNLLA GATAGAIGAAAGSPFDLVKVRMQAANMYKNDPQFVGYSSSFAAFKQIIQKEGFKGLTRGM LTSAQRTAVGSAIQLSTYGSCKNLVLNFVDDGIYAYIISSMVAGFIVTFGMNPFDVARTR LYFQGKGNSHGEIYKGLMDCVYKTVKKEGFGAVYKGFWAHYLRLGPHTILTLVFWEQFKK LFSGEL
Uniprot No.

Target Background

Function
Mitochondrial solute carriers transport metabolites, nucleotides, and cofactors across the mitochondrial inner membrane. This protein transports oxaloacetate and sulfate.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is ucpA and what are its structural characteristics?

UcpA (Uncoupler protein A) is a mitochondrial substrate carrier family protein found in Dictyostelium discoideum. It consists of 306 amino acids and belongs to the solute carrier family 25 (SLC25A35 homolog) . The protein contains characteristic transmembrane domains typical of mitochondrial carrier proteins, with a structure that facilitates its function in transporting molecules across the mitochondrial membrane. The full amino acid sequence is: MSVNLNNNKNNKNKVAIGFISGSLASICATTVTNPIELVKTRLQLQGELQLSQRIYNGVWDAFKQIYKTEGIRGLQSGLIPAYFSQATMQGIRLGSFDLISNALGAKPNQDYFFLKNLLAGATAGAIGAAAGSPFDLVKVRMQAANMYKNDPQFVGYSSSFAAFKQIIQKEGFKGLTRGMLTSAQRTAVGSAIQLSTYGSCKNLVLNFVDDGIYAYIISSMVAGFIVTFGMNPFDVARTRLYFQGKGNSHGEIYKGLMDCVYKTVKKEGFGAVYKGFWAHYLRLGPHTILTLVFWEQFKKLFSGEL .

How does ucpA function within the mitochondrial carrier system?

UcpA functions as part of the mitochondrial carrier system (MCS) that transports small molecules between the mitochondrial matrix and the cytoplasm . As an uncoupling protein, ucpA is stimulated by free fatty acids and is poorly sensitive to guanosine triphosphate (GTP) . Its primary function appears to be in energy dissipation, allowing protons to re-enter the mitochondrial matrix without generating ATP, thereby uncoupling electron transport from oxidative phosphorylation. This process generates heat and regulates reactive oxygen species (ROS) production, which is crucial for cellular adaptation to environmental stresses .

What is the expression pattern of ucpA during Dictyostelium development?

Unlike alternative oxidase (AOX), whose expression varies significantly during different growth phases, ucpA shows constant expression levels throughout all conditions of Dictyostelium development . This stable expression pattern—from the unicellular amoeboid stage through starvation-induced aggregation and into the multicellular developmental phase—suggests that ucpA serves a fundamental and persistent metabolic role in Dictyostelium discoideum . The consistent expression indicates a permanent need for the protein's function in energy homeostasis regardless of the developmental stage.

What are the recommended storage and handling conditions for recombinant ucpA protein?

For optimal stability and functionality of recombinant ucpA protein, the following storage and handling protocols are recommended:

Storage ParameterRecommendation
Short-term storage4°C for up to one week
Long-term storage-20°C/-80°C with aliquoting to avoid freeze-thaw cycles
Storage bufferTris/PBS-based buffer with 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to 0.1-1.0 mg/mL
Glycerol concentrationAdd 5-50% glycerol (final concentration) for long-term storage
Handling precautionBriefly centrifuge vial before opening to bring contents to bottom

It is important to note that repeated freezing and thawing can significantly decrease protein activity and should be avoided .

How can researchers effectively design experiments to study ucpA function in vitro?

When designing experiments to study ucpA function, researchers should consider:

  • Activation conditions: Include free fatty acids in experimental buffers as they stimulate ucpA activity .

  • Control experiments: Compare ucpA activity in the presence and absence of known uncoupling protein inhibitors to confirm specificity.

  • Measurement approaches: Assess uncoupling activity through:

    • Oxygen consumption measurements in isolated mitochondria

    • Membrane potential analysis using fluorescent probes

    • Thermal output measurements in reconstituted systems

  • Reconstitution systems: For detailed biophysical studies, reconstitute purified recombinant ucpA into liposomes with defined lipid compositions.

  • Activity assays: When studying the collaboration between ucpA and AOX, design experiments that can activate each protein separately and together to observe their synergistic effects on energy dissipation .

  • Experimental design considerations: Ensure proper randomization with respect to phenotypes of interest to avoid confounding factors that might lead to spurious associations . This is particularly important when combining multiple experiments to increase statistical power.

What purification methods are most effective for recombinant ucpA protein?

The recombinant ucpA protein with N-terminal His-tag can be effectively purified using the following approach:

  • Expression system: Express in E. coli with an N-terminal His-tag for affinity purification .

  • Affinity chromatography: Use immobilized metal affinity chromatography (IMAC) with Ni-NTA resin to capture the His-tagged protein.

  • Buffer optimization: During purification, maintain physiological pH (7.2-8.0) and include mild detergents to stabilize the membrane protein.

  • Quality control: Verify purity using SDS-PAGE (should be greater than 90%) .

  • Functional verification: Test the purified protein for activity using reconstitution into liposomes followed by proton transport assays.

  • Storage optimization: After purification, lyophilize the protein for long-term stability, or store in buffer with glycerol at -80°C .

How does ucpA collaborate with alternative oxidase (AOX) in energy dissipation mechanisms?

UcpA and AOX collaborate in a complementary manner to dissipate energy in Dictyostelium mitochondria. Their interaction can be characterized as follows:

  • Mechanism of collaboration: When both proteins are activated simultaneously, they create an efficient energy dissipation system. AOX bypasses complexes III and IV of the electron transport chain, reducing the proton gradient, while ucpA directly dissipates the proton gradient by allowing protons to re-enter the matrix without ATP synthesis .

  • Activation triggers: AOX is stimulated by purine mononucleosides and maintains a monomeric structure, whereas ucpA is activated by free fatty acids and shows minimal sensitivity to GTP inhibition, unlike mammalian UCPs .

  • Physiological significance: This dual system provides Dictyostelium with flexible control over energy metabolism, allowing rapid adaptation to environmental changes and metabolic needs.

  • Developmental regulation: While ucpA expression remains constant across all conditions, AOX expression varies significantly, decreasing from exponential to stationary growth phase but showing lesser reduction during starvation-induced aggregation . This differential regulation suggests distinct but complementary roles in energy homeostasis.

  • Research approach: To study this collaboration, researchers should design experiments that can selectively activate or inhibit each protein while monitoring mitochondrial membrane potential, oxygen consumption, and heat production.

What are the implications of ucpA's constant expression pattern compared to the variable expression of AOX?

The contrasting expression patterns of ucpA and AOX have significant implications for Dictyostelium metabolism and development:

  • Metabolic requirements: UcpA's constant expression suggests it fulfills a fundamental metabolic requirement throughout all stages of Dictyostelium's life cycle, while AOX may serve more stage-specific functions .

  • Stress response mechanisms: The stable presence of ucpA provides continuous protection against oxidative stress through moderating reactive oxygen species production.

  • Developmental roles: AOX's expression pattern suggests a specific role in cell differentiation, particularly in protecting prespore cells from programmed cell death during development . In contrast, ucpA's constant presence points to a more general metabolic function.

  • Energy homeostasis: Together, these proteins may allow fine-tuned regulation of energy production versus dissipation, with ucpA providing baseline uncoupling and AOX offering additional capacity when needed.

  • Research directions: This differential expression warrants investigation into the transcriptional and post-transcriptional mechanisms controlling these proteins, potentially revealing novel regulatory circuits in mitochondrial energy metabolism.

How does Dictyostelium ucpA compare to mammalian uncoupling proteins?

Dictyostelium ucpA shares several features with mammalian uncoupling proteins, but also exhibits important differences:

FeatureDictyostelium ucpAMammalian UCPs
ActivationStimulated by free fatty acidsPrimarily activated by free fatty acids
GTP sensitivityPoorly sensitive to GTPHighly sensitive to GTP (especially UCP1)
Expression patternConstant across conditionsTissue-specific and condition-dependent
Functional partnersWorks with AOXNo AOX collaboration in mammals
Evolutionary contextPresent in a social amoebaDiversified into multiple isoforms (UCP1-5)
Primary functionEnergy dissipationVaries: thermogenesis (UCP1), ROS regulation (UCP2/3)

These differences make Dictyostelium ucpA a valuable comparative model for understanding the evolution and diversification of uncoupling proteins across eukaryotic lineages .

How can Dictyostelium ucpA research inform studies on human mitochondrial diseases?

Dictyostelium discoideum provides a valuable model for studying mitochondrial diseases for several reasons:

  • Conserved mechanisms: Many mitochondrial functions and proteins are conserved between Dictyostelium and humans, making it relevant for studying fundamental mitochondrial processes .

  • Experimental advantages: Dictyostelium offers simpler genetics (low redundancy genome), rapid growth, and both unicellular and multicellular stages, allowing comprehensive phenotypic analysis .

  • Disease relevance: Research on ucpA can provide insights into human diseases associated with mitochondrial carrier proteins (SLC25 family), some of which cause known human pathologies .

  • Specific applications:

    • Modeling mitochondrial dysfunction in neurodegenerative diseases

    • Understanding energy metabolism disruptions in rare genetic disorders

    • Screening potential therapeutic compounds targeting mitochondrial carriers

  • Recent applications: Dictyostelium has been successfully used to study Parkinson's disease-associated mitochondrial dysfunction, demonstrating its value for investigating human mitochondrial diseases .

  • Research approach: For translational studies, researchers can express human mitochondrial carrier proteins in Dictyostelium ucpA knockout strains to assess functional conservation and disease-associated mutations.

What methodological considerations are important when using recombinant ucpA in biophysical studies?

When conducting biophysical studies with recombinant ucpA, researchers should consider:

  • Protein stability: The membrane protein nature of ucpA requires careful handling to maintain its native conformation. Using appropriate detergents during purification and reconstitution is crucial .

  • Buffer composition: The choice of buffer can significantly impact protein stability and activity. Tris/PBS-based buffers with 6% trehalose at pH 8.0 have been shown to be effective for maintaining ucpA stability .

  • Reconstitution systems: For functional studies, reconstitute ucpA into liposomes with lipid compositions that mimic the mitochondrial inner membrane. The protein-to-lipid ratio should be optimized for each specific application.

  • Activity assays: Design assays that can specifically measure ucpA-mediated proton transport, distinguishing it from non-specific membrane leakage.

  • Experimental controls: Include appropriate controls such as:

    • Heat-inactivated protein samples

    • Known uncoupling protein inhibitors

    • Mutated versions of ucpA with altered function

  • Data interpretation: When analyzing biophysical data, consider the potential effects of the His-tag on protein function and interaction with lipids or other molecules.

  • Experimental design: Ensure proper randomization in experimental design to avoid confounding factors that might lead to spurious associations in your data analysis .

What are the potential roles of ucpA in Dictyostelium development and differentiation?

Based on current knowledge, several potential roles for ucpA in Dictyostelium development warrant further investigation:

  • Metabolic regulation during differentiation: UcpA may help regulate the metabolic shifts required during the transition from unicellular to multicellular stages of Dictyostelium development .

  • Oxidative stress protection: The protein likely plays a role in protecting developing cells from oxidative damage, particularly during periods of metabolic stress such as starvation-induced aggregation .

  • Cell fate determination: While AOX has been implicated in protecting prespore cells from programmed cell death , ucpA's constant expression might indicate a role in maintaining metabolic homeostasis across all cell types during differentiation.

  • Signal transduction: Changes in mitochondrial membrane potential mediated by ucpA could potentially influence calcium signaling or other second messenger systems important for development.

  • Research approaches: To explore these roles, researchers could:

    • Generate ucpA knockout strains and assess developmental phenotypes

    • Perform cell-type specific expression analysis during development

    • Use imaging techniques to monitor mitochondrial function during development

    • Combine ucpA and AOX mutations to assess synergistic developmental effects

How might advanced techniques be applied to better understand ucpA structure-function relationships?

Several cutting-edge techniques could advance our understanding of ucpA:

  • Cryo-electron microscopy: Determining the high-resolution structure of ucpA would provide insights into its transport mechanism and regulation.

  • Molecular dynamics simulations: Using the amino acid sequence provided , researchers could model ucpA structure and simulate its interactions with the mitochondrial membrane, substrates, and regulators.

  • Site-directed mutagenesis: Systematic mutation of conserved residues could identify key amino acids involved in substrate binding, transport, and regulation.

  • Single-molecule techniques: These could reveal the conformational changes associated with transport and regulatory events.

  • Metabolomics integration: Combining structural studies with metabolomic analysis of ucpA knockout or overexpression strains would link structural features to physiological effects.

  • Protein-protein interaction studies: Identifying ucpA interaction partners could reveal regulatory mechanisms and functional connections within mitochondrial metabolism.

  • CRISPR-Cas9 genome editing: Creating precise mutations that mimic human disease variants in related carriers would create valuable disease models.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.