Recombinant Dictyostelium discoideum Mitoferrin (mcfF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate this in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
mcfF; DDB_G0269470; Mitoferrin; Mitochondrial substrate carrier family protein F
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
mcfF
Target Protein Sequence
MGGDHGHSHGDEGGSFYVHLIAGAAAGFAEHCGMYPIDTIKTHIQAIKPGAMQTSSLQIT KHIIQQHGITGLFRGLTAVAAGAAPSHAVHFSIYELLKFKFIGSDEDHHPIKVGIAGAIA TMTSEAVASPMDVVKQRLQLQITDYKGLTDCTKRIWVKEGIRGFYSGYTTTLVMNVPYNI VYFASYESLKKIIQPWFNNKNPEERSYQLIDHLVAGGGAGMLAAAFTNPFDVVKTRLQTQ SDFIASSTINSAKSIKRYGGMMDAMKTIWIEEGMDGYLRGMKPRMVFHSMSSAIVWSVYE YFKFILGE
Uniprot No.

Target Background

Function
Mitochondrial solute carriers facilitate the transport of metabolites, nucleotides, and cofactors across the mitochondrial inner membrane. Mitochondrial iron transporter mediating iron uptake. It is likely essential for heme synthesis of hemoproteins and Fe-S cluster assembly.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Dictyostelium discoideum Mitoferrin (mcfF) and why is it significant for research?

Mitoferrin (mcfF) is a mitochondrial iron transporter protein found in Dictyostelium discoideum that facilitates iron delivery into the mitochondrion . This function is critical for numerous biochemical processes, as iron serves as an essential cofactor for many mitochondrial enzymes involved in energy production and metabolism. The significance of mcfF for research stems from D. discoideum's established position as a model organism that exhibits both unicellular and multicellular stages in its life cycle, providing insights into fundamental cellular processes . Despite lacking a central nervous system, D. discoideum contains many homologs of human genes and conserved cellular pathways, making it valuable for studying basic biological mechanisms that are relevant to human health and disease .

How does mcfF function in Dictyostelium discoideum's mitochondrial biology?

In D. discoideum, mcfF functions as a key component of mitochondrial iron homeostasis by transporting iron across the inner mitochondrial membrane . This process is essential for the assembly of iron-sulfur clusters and heme groups, which are critical cofactors for respiratory chain complexes. During the organism's development and transition between unicellular and multicellular stages, mitochondrial processes undergo significant changes in response to environmental cues such as starvation . Research has shown that mitochondrial coupling capacity decreases during the streams (S) stage, while coupling efficiency decreases during both aggregation (A) and streams stages . These changes are associated with alterations in mitochondrial proteome composition, suggesting that mcfF-mediated iron transport may be regulated differently during various developmental stages to accommodate changing metabolic demands.

What specific role does mcfF play during Dictyostelium discoideum development?

During D. discoideum development, the organism transitions from unicellular to multicellular forms in response to starvation, triggering a complex series of cellular reprogramming events. Proteomic studies have revealed significant changes in mitochondrial protein expression during early developmental stages (unicellular, aggregation, and streams stages) . While specific data on mcfF regulation is limited in the provided search results, mitochondrial proteins show characteristic tendencies associated with adaptation to starvation and a switch to gluconeogenesis during development . As a mitochondrial iron transporter, mcfF likely contributes to this adaptive response by ensuring appropriate iron availability for essential mitochondrial functions during the developmental transition, potentially participating in the observed downregulation of mitochondrial processes during early developmental stages .

How does the function of mcfF in D. discoideum compare to mitoferrins in other model organisms?

Mitoferrins represent a conserved family of proteins that mediate mitochondrial iron import across evolutionary diverse organisms. While the provided search results don't offer direct comparative data, research context suggests that D. discoideum mcfF shares functional homology with mitoferrins found in other eukaryotes. The protein's full-length sequence spans 308 amino acids, as indicated by the recombinant protein specifications .

Comparative analysis would typically examine sequence conservation, particularly of the three conserved histidine residues mentioned in search result that contribute to mitochondrial iron transport function. These histidine residues likely play similar roles in coordinating iron during transport across species. D. discoideum, as a professional phagocyte with highly conserved cellular processes, offers unique advantages for studying iron transport in the context of phagocytosis, antimicrobial responses, and cell-autonomous defense mechanisms . Unlike mammalian models, D. discoideum allows for relatively easier genetic manipulation to study mitoferrin function in the absence of the complexity introduced by tissue-specific regulation found in higher eukaryotes.

What is known about the relationship between mcfF and pathogen resistance in D. discoideum?

D. discoideum serves as an established model for studying host-pathogen interactions, particularly for bacterial pathogens like Legionella pneumophila, Mycobacterium species, and Pseudomonas aeruginosa . While the provided search results don't explicitly connect mcfF to pathogen resistance, the protein's role in iron transport has significant implications for host-pathogen dynamics based on established principles of nutritional immunity.

Iron availability represents a critical battleground during infection, as both host and pathogen require this essential nutrient. The manipulation of metal ion concentrations, including iron (Fe²⁺), serves as a key antimicrobial mechanism in phagocytes . D. discoideum employs strategies to either sequester iron to restrict microbial growth or generate high local concentrations to poison invading microbes . As the mitochondrial iron transporter, mcfF likely plays a role in this process by regulating iron distribution within the cell during infection. Alterations in mcfF expression or function could potentially affect D. discoideum's ability to withstand certain infections through mechanisms related to iron homeostasis and mitochondrial function.

What are the optimal conditions for expressing and purifying recombinant D. discoideum mcfF protein?

Based on the available information, recombinant full-length D. discoideum mcfF protein can be successfully expressed in E. coli with a His-tag . For optimal expression and purification, researchers should consider the following protocol:

Expression System:

  • Host: E. coli (BL21 or similar expression strain)

  • Vector: pET or similar expression vector with T7 promoter

  • Tag: N- or C-terminal His-tag for purification

  • Protein Length: Full-length mcfF (1-308 amino acids)

Expression Conditions:

  • Induction: 0.5-1.0 mM IPTG when culture reaches OD600 of 0.6-0.8

  • Temperature: 18-25°C (lower temperatures may improve proper folding)

  • Duration: 16-20 hours

  • Media: LB or 2xYT supplemented with appropriate antibiotics

Purification Protocol:

  • Cell lysis using sonication or French press in buffer containing:

    • 50 mM Tris-HCl, pH 8.0

    • 300 mM NaCl

    • 10% glycerol

    • 1 mM PMSF

    • Protease inhibitor cocktail

  • Immobilized metal affinity chromatography (IMAC):

    • Ni-NTA or similar resin

    • Binding buffer: 50 mM Tris-HCl, pH 8.0, 300 mM NaCl, 10 mM imidazole

    • Wash buffer: 50 mM Tris-HCl, pH 8.0, 300 mM NaCl, 20-40 mM imidazole

    • Elution buffer: 50 mM Tris-HCl, pH 8.0, 300 mM NaCl, 250-500 mM imidazole

  • Size exclusion chromatography for further purification:

    • Buffer: 20 mM HEPES, pH 7.4, 150 mM NaCl

Since mcfF is a membrane protein, inclusion of detergents like DDM (n-Dodecyl β-D-maltoside) at 0.03-0.05% throughout purification may improve yield and stability of the functional protein.

What experimental approaches are most effective for studying mcfF function in D. discoideum?

Several complementary approaches are effective for studying mcfF function in D. discoideum:

1. Genetic Manipulation:

  • Gene knockout or knockdown using CRISPR-Cas9 or RNAi

  • Complementation with wild-type or mutant versions

  • Fluorescent protein tagging for localization studies

2. Biochemical Assays:

  • Iron transport assays using radioactive ⁵⁵Fe or fluorescent iron probes

  • Measurement of mitochondrial iron content using ICP-MS or colorimetric assays

  • Enzymatic activity assays for iron-dependent mitochondrial enzymes

3. Physiological Measurements:

  • Oxygen consumption measurement using the Clarke electrode to assess mitochondrial function

  • Analysis of mitochondrial coupling capacity and efficiency

  • Determination of spare respiratory capacity

4. Proteomic Analysis:

  • Comparative proteomics of mitochondria across developmental stages

  • Analysis of iron-binding proteins and their modifications

  • Identification of mcfF-interacting proteins

5. Cellular Response Studies:

  • Stress response experiments (oxidative stress, iron limitation/overload)

  • Development assays under various iron conditions

  • Pathogen infection studies to assess the role of mcfF in host defense

The combination of oxygen consumption measurements and proteomic studies has proven particularly informative for understanding mitochondrial adaptations during D. discoideum development . Similar approaches would be effective for characterizing mcfF function and regulation.

How can researchers effectively analyze the impact of mcfF on iron metabolism in D. discoideum?

To effectively analyze the impact of mcfF on iron metabolism in D. discoideum, researchers should employ a multi-faceted approach:

1. Iron Distribution Analysis:

  • Subcellular fractionation followed by iron quantification (ICP-MS)

  • Histochemical techniques (Perls' Prussian blue staining) for iron visualization

  • Fluorescent iron sensors for dynamic live-cell imaging

2. Expression Analysis:

  • qRT-PCR to measure mcfF transcript levels under varying iron conditions

  • Western blotting for mcfF protein expression

  • Promoter-reporter constructs to study transcriptional regulation

3. Mutational Analysis:

  • Site-directed mutagenesis of conserved histidine residues implicated in iron transport

  • Functional complementation with mutant versions of mcfF

  • Heterologous expression of mcfF in yeast mitoferrin mutants

4. Physiological Impact Assessment:

  • Growth curves under varying iron availability

  • Developmental assays with iron chelators or supplementation

  • Analysis of mitochondrial function using oxygen consumption measurements

5. -Omics Approaches:

  • Transcriptomics to identify iron-responsive genes affected by mcfF status

  • Proteomics to characterize changes in iron-binding proteins

  • Metabolomics to assess impact on iron-dependent metabolic pathways

These approaches can be integrated into a comprehensive research program that examines mcfF function across different developmental stages of D. discoideum, particularly the unicellular (U), aggregation (A), and streams (S) stages known to exhibit distinct mitochondrial properties .

How can studies of D. discoideum mcfF contribute to understanding human diseases?

Research on D. discoideum mcfF can significantly contribute to understanding human diseases through several mechanisms:

Neurodegenerative Disorders:
D. discoideum serves as an established model for studying proteins implicated in neurodegenerative diseases such as Alzheimer's, Parkinson's, and Huntington's diseases . Mitochondrial dysfunction and altered iron metabolism are key features of these disorders. As a mitochondrial iron transporter, mcfF research can provide insights into fundamental processes of iron handling that may be disrupted in neurodegeneration.

Mitochondrial Disorders:
Many human mitochondrial disorders involve disruptions in iron-sulfur cluster biogenesis and iron homeostasis. Studies of mcfF in D. discoideum can elucidate conserved mechanisms of mitochondrial iron transport that are relevant to these conditions. The simplicity of D. discoideum as a model organism allows for clearer interpretation of mitochondrial phenotypes compared to the complexity of human tissues .

Metal-Related Disorders:
Disorders of iron metabolism, including hemochromatosis and certain anemias, involve dysregulation of iron transport proteins. While D. discoideum lacks blood cells, the fundamental mechanisms of cellular iron uptake, storage, and utilization are conserved, making mcfF studies relevant to understanding these conditions.

Infectious Diseases:
D. discoideum is used as a host model for various intracellular pathogens, including Legionella pneumophila, Mycobacterium species, and others . Since iron acquisition is critical for pathogen survival, understanding how mcfF contributes to host iron distribution during infection could inform therapeutic strategies for infectious diseases.

The genetic tractability of D. discoideum allows for easy manipulation of mcfF and related genes, facilitating the study of human disease-associated variants in a simplified cellular context.

What is the potential for using recombinant mcfF in structural biology studies?

Recombinant D. discoideum mcfF offers several advantages for structural biology studies:

Protein Production:
The availability of recombinant full-length His-tagged mcfF protein from E. coli expression systems provides a foundation for structural studies. The protein encompasses 308 amino acids and can be produced with sufficient purity for structural investigations.

Structural Techniques Applicable to mcfF:

Structural Insights to Be Gained:

  • Configuration of the three conserved histidine residues that contribute to iron transport

  • Conformational changes associated with iron binding and release

  • Membrane integration topology

  • Oligomerization state in the mitochondrial membrane

  • Interaction interfaces with potential protein partners

Structural information would complement the existing functional studies and could inform the design of specific inhibitors or enhancers of mitoferrin activity for both research and potential therapeutic applications.

How might the function of mcfF interact with other cellular processes during D. discoideum development?

The function of mcfF likely intersects with multiple cellular processes during D. discoideum development, creating a complex network of interactions:

1. Energy Metabolism Adaptation:
During the transition from unicellular to multicellular stages, D. discoideum undergoes significant metabolic reprogramming in response to starvation . Proteomic studies have shown changes in mitochondrial proteins during these transitions, suggesting altered energy production strategies . As an iron transporter, mcfF likely plays a role in this metabolic adaptation by ensuring appropriate iron availability for shifting metabolic demands, potentially contributing to the observed decreases in mitochondrial coupling capacity and efficiency during development .

2. Autophagy Interactions:
D. discoideum utilizes autophagy as both a nutrient acquisition pathway and a defense mechanism . During development and starvation, autophagy becomes crucial for recycling cellular components. mcfF may interact with this process by:

  • Contributing to the redistribution of iron from degraded mitochondria

  • Participating in mitophagy quality control processes

  • Ensuring iron availability for essential functions during nutrient limitation

3. Developmental Signaling:
Iron-dependent enzymes participate in various signaling pathways that regulate development. mcfF-mediated iron transport could affect:

  • ROS-dependent signaling through iron's role in ROS generation

  • Activity of iron-dependent enzymes involved in cAMP signaling

  • Iron-responsive gene expression changes during development

4. Defense Against Environmental Challenges:
As a soil-dwelling organism, D. discoideum encounters various microbes and must defend against potential pathogens . mcfF may contribute to this defense by:

  • Participating in nutritional immunity mechanisms that limit iron availability to pathogens

  • Supporting energy production needed for phagocytosis and other defense activities

  • Contributing to metal poisoning mechanisms used against invading microbes

The integration of mcfF function with these processes likely varies across developmental stages, as evidenced by the proteomic differences observed between unicellular, aggregation, and streams stages .

What are the key challenges in studying mcfF function and how can they be addressed?

Studying mcfF function in D. discoideum presents several challenges that require specific technical approaches:

Challenge 1: Membrane Protein Analysis
mcfF is a membrane protein localized to the mitochondrial inner membrane, making its isolation and characterization technically demanding.

Solutions:

  • Use mild detergents (DDM, LMNG) for extraction while maintaining protein function

  • Employ nanodiscs or liposomes to study purified protein in membrane-like environments

  • Utilize complementary approaches like in-cell functional assays to avoid isolation issues

Challenge 2: Iron Transport Measurement
Directly measuring iron transport activity is technically challenging due to iron's chemical properties.

Solutions:

  • Develop fluorescent iron sensors with mitochondrial targeting

  • Use radioactive ⁵⁵Fe in transport assays with isolated mitochondria

  • Employ indirect measurements such as activity of iron-dependent enzymes

  • Combine genetic manipulation with physiological readouts like oxygen consumption

Challenge 3: Distinguishing Direct from Indirect Effects
Manipulating mcfF may cause broad mitochondrial defects, making it difficult to distinguish primary from secondary effects.

Solutions:

  • Use acute inducible systems for mcfF depletion to capture immediate effects

  • Create point mutations affecting iron transport but not protein stability

  • Perform time-course experiments following mcfF manipulation

  • Employ comprehensive -omics approaches to map the cascade of effects

Challenge 4: Developmental Complexity
D. discoideum's developmental transitions involve numerous changes that can confound analysis of mcfF-specific effects.

Solutions:

  • Establish stage-specific requirements for mcfF using conditional expression systems

  • Compare wild-type and mcfF-modified strains across multiple developmental time points

  • Use quantitative approaches to measure developmental progression precisely

  • Integrate proteomic data from different developmental stages

What protocols can be used to assess the interaction between mcfF and other mitochondrial proteins?

The following protocols can effectively characterize interactions between mcfF and other mitochondrial proteins:

1. Affinity Purification-Mass Spectrometry (AP-MS):

  • Express tagged mcfF (His-tag or FLAG-tag) in D. discoideum

  • Isolate mitochondria and solubilize with mild detergents

  • Perform affinity purification followed by mass spectrometry to identify interacting proteins

  • Compare results across different developmental stages to detect dynamic interactions

2. Proximity Labeling Techniques:

  • Express mcfF fused to BioID or APEX2 in D. discoideum

  • Allow promiscuous biotinylation of proximal proteins

  • Isolate biotinylated proteins using streptavidin beads

  • Identify labeled proteins by mass spectrometry

3. Co-Immunoprecipitation (Co-IP):

  • Generate antibodies against mcfF or use tag-based detection

  • Perform Co-IP from mitochondrial extracts

  • Confirm interactions by Western blotting for specific candidate proteins

  • Validate interactions under different iron conditions

4. Fluorescence Resonance Energy Transfer (FRET):

  • Create fluorescent protein fusions with mcfF and candidate interactors

  • Express in D. discoideum and analyze by confocal microscopy

  • Measure FRET efficiency to quantify interactions

  • Perform under various conditions (iron depletion/repletion)

5. Split-Reporter Systems:

  • Fuse mcfF and candidate interactors to complementary fragments of a reporter (split-GFP, split-luciferase)

  • Express in D. discoideum and measure reporter reconstitution

  • Use to screen libraries of mitochondrial proteins for interactions

6. Yeast Two-Hybrid with Membrane Protein Adaptations:

  • Use split-ubiquitin or MYTH systems designed for membrane proteins

  • Screen D. discoideum cDNA libraries for mcfF interactors

  • Validate hits in the native cellular context

These approaches can be integrated with functional assays to determine how protein interactions affect mcfF-mediated iron transport activity and mitochondrial function in D. discoideum.

How can researchers effectively compare mcfF function across different developmental stages of D. discoideum?

To effectively compare mcfF function across different developmental stages of D. discoideum, researchers should implement a systematic approach that integrates multiple analytical techniques:

1. Expression and Localization Analysis:

  • Stage-specific qRT-PCR to quantify mcfF transcript levels

  • Western blotting of fractionated samples to measure protein abundance

  • Fluorescent protein tagging for live imaging across developmental transitions

  • Immunoelectron microscopy to assess submitochondrial localization changes

2. Functional Assessment:

  • Oxygen consumption measurements as performed in previous studies

  • Analysis of mitochondrial coupling capacity and efficiency at each stage

  • Iron transport assays with isolated mitochondria from different stages

  • Activity measurement of iron-dependent enzymes across development

3. Proteomic Integration:

  • Comparative proteomics of mitochondria from unicellular (U), aggregation (A), and streams (S) stages

  • Analysis of post-translational modifications affecting mcfF

  • Quantification of iron-binding proteins in the mitochondrial proteome

  • Identification of stage-specific mcfF interacting partners

4. Genetic Manipulation:

  • Stage-specific knockdown using inducible RNAi systems

  • Complementation with fluorescently tagged versions for simultaneous tracking

  • Expression of dominant-negative mutants at specific developmental time points

  • CRISPR-Cas9 genome editing to create tagged endogenous protein

5. Developmental Impact Analysis:

  • Quantitative assessment of developmental progression in mcfF mutants

  • Time-lapse microscopy to track developmental milestones

  • Cell-type specific markers to evaluate differentiation

  • Phenotypic rescue experiments with timed expression

6. Metabolic Profiling:

  • Stage-specific metabolomics focusing on iron-dependent pathways

  • Measurement of labile iron pools in mitochondria across development

  • Tracking metabolic shifts between oxidative phosphorylation and glycolysis

  • Analysis of reactive oxygen species production and antioxidant status

This multi-faceted approach would enable researchers to construct a comprehensive picture of how mcfF function and regulation change during the transition from unicellular to multicellular stages in D. discoideum, building upon the foundations established in previous studies of mitochondrial adaptations during development .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.