Recombinant Dictyostelium discoideum Myb-like protein R (mybR)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mybR; DDB_G0292182; Myb-like protein R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-394
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
mybR
Target Protein Sequence
MDEPSTDKILIGAQIITTVITLFTGVFEFIIAAKSKMKRMKSEQMFSVNQDGLIHIIKSL LPGRNIIFISNAPTSTTDPSFNSQTMKNFLKVIFRLLPFFIGAVFIHLNIIPFHHLIIFT ENGKWYFDSIQEELIPIVKERLKQIMSSQPDVIFACGAVVRDIFYMYLEEGSIEMFEING NLKVDINKFKKIYTTVSDKNISPQSNEILDLFEFDTTKSSYEDVIEEYSKFENDSLGSFE NPDYSGFHLLSKRKWNNKEALIVGIGKSNNKTTVQIKGDLLDKGYFRTELAIDTYFDRNK VLINKMVKNFKSTQEIIKPSPVISGNWSLDEQKALMVEVSTLGNKSEINWFFISKQLFLK GISRNARECQRKHESIQYVGLSGNPKGKFKRTFD
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Myb-like proteins in Dictyostelium discoideum?

Dictyostelium Myb-like proteins, such as DdMYB2, contain DNA-binding domains composed of three Myb repeats (R1, R2, and R3). The homology with corresponding repeats in c-Myb varies: R1 shows the strongest identity (43%), while R2 and R3 show 30% and 27% identity, respectively. A distinctive feature of DdMYB2's R3 domain is a 12-amino-acid insertion between the second and third helix. Secondary structure prediction suggests that the Myb repeats of DdMYB2 have a structure similar to that of c-Myb. Additionally, a potential nuclear localization signal sequence (408-IKKKRERKR) is located just before the Myb domain, facilitating nuclear transport of the protein .

How does DdMYB2 regulate Dictyostelium development?

DdMYB2 functions as a critical regulator of early development in Dictyostelium discoideum by mediating the starvation response. Upon nutrient deprivation, DdMYB2 is required for the expression of adenylyl cyclase (ACA), one of the first genes expressed during starvation. ACA produces extracellular cAMP, which serves as both a chemoattractant and differentiation signal for neighboring cells. DdMYB2-null cells show undetectable levels of ACA transcript and no cAMP production, rendering them incapable of aggregation. This developmental defect can be rescued by either adding extracellular cAMP or by ectopic expression of ACA from a constitutive promoter, confirming that DdMYB2's primary developmental function is to induce ACA expression in response to starvation signals .

What genetic manipulation techniques are most effective for studying Myb-like proteins in Dictyostelium?

Several genetic approaches have proven effective for studying Myb-like proteins in Dictyostelium. Insertional mutagenesis using restriction enzyme-mediated integration (REMI) has been particularly valuable for identifying genes involved in development, including DdMYB2. In this approach, a linearized plasmid carrying a selection marker is integrated into the host genome with the help of a restriction enzyme, creating knockout mutants. For Myb-related genes, homologous recombination techniques can be used for targeted gene disruption or modification. Recent advances have improved transfection protocols for both axenic laboratory strains and non-axenic wild-type cells, expanding the genetic toolbox available to researchers. When studying Myb transcription factors, expressing tagged versions (GFP, HA) can facilitate localization studies and chromatin immunoprecipitation experiments to identify target genes .

What are the optimal conditions for expressing and purifying recombinant Dictyostelium Myb-like proteins?

For optimal expression and purification of recombinant Dictyostelium Myb-like proteins, researchers should consider a multi-faceted approach:

Expression SystemAdvantagesChallengesRecommended Conditions
E. coliHigh yield, easy manipulationPotential misfolding of eukaryotic proteinsBL21(DE3) strain, low temperature induction (16-18°C), inclusion of chaperones
DictyosteliumNative post-translational modificationsLower yield than bacterial systemsConstitutive actin15 promoter, inducible discoidin promoter for toxic proteins
BaculovirusEukaryotic processing, high yieldMore complex than bacterial systemsSf9 or High Five cells, 27°C, harvest 48-72h post-infection

For purification, a tandem approach using affinity chromatography (His-tag or GST-tag) followed by size exclusion chromatography typically yields the purest protein. When purifying DNA-binding domains alone, include 300-500 mM NaCl in buffers to prevent non-specific DNA interactions. For structural studies, supplement buffers with 5-10% glycerol and 1-2 mM DTT to enhance stability during concentration and storage .

How can ChIP-seq be optimized to identify direct targets of Dictyostelium Myb-like transcription factors?

Optimizing ChIP-seq for Dictyostelium Myb-like transcription factors requires several specialized considerations. First, create tagged versions of the Myb protein (e.g., with FLAG, HA, or V5 tags) that can be immunoprecipitated with commercially available antibodies, as specific antibodies against native Dictyostelium Myb proteins may be unavailable. Verify that the tagged protein retains functionality by complementation tests in corresponding null mutants. For crosslinking, use 1% formaldehyde for 10-15 minutes, as Dictyostelium cells have unique cell walls requiring optimized fixation conditions. During sonication, aim for DNA fragments of 200-400 bp for optimal resolution. For bioinformatic analysis, use peak-calling algorithms that account for the AT-rich nature of the Dictyostelium genome (approximately 77% AT content) to avoid bias. Finally, validate ChIP-seq results with reporter gene assays or in vitro DNA binding assays using recombinant Myb domains to confirm direct binding to identified sequences. This approach has successfully identified adenylyl cyclase (ACA) as a target gene for DdMYB2, explaining the developmental defects observed in DdMYB2-null mutants .

What role do Dictyostelium Myb-like proteins play in DNA damage response pathways?

Recent evidence suggests that Dictyostelium Myb-like proteins may play critical roles in DNA damage response pathways, linking developmental regulation to genome stability. Dictyostelium discoideum exhibits remarkable resistance to DNA damaging agents and possesses orthologs of several DNA repair pathway components otherwise limited to vertebrates, including the Fanconi Anemia DNA inter-strand crosslink and DNA strand break repair pathways. Myb-family transcription factors in other systems regulate genes involved in cell cycle control and DNA repair. Although direct evidence linking Dictyostelium Myb proteins to DNA repair is still emerging, the presence of multiple Myb repeats in these proteins suggests they could recognize specific DNA sequences that become exposed during DNA damage. Research aimed at identifying the full complement of target genes for DdMYB2 and other Myb-like proteins using ChIP-seq and RNA-seq in DNA damage conditions could reveal novel connections between developmental regulation and genome maintenance pathways. This has significant implications for understanding how these pathways can be targeted to treat a variety of human pathologies, including cancer .

How do post-translational modifications regulate the activity of Dictyostelium Myb-like proteins?

Post-translational modifications (PTMs) likely play crucial roles in regulating Dictyostelium Myb-like protein activity, though this area remains relatively unexplored. Based on knowledge of Myb proteins in other systems, several PTMs are predicted to regulate DdMYB2 and related proteins:

Modification TypePredicted SitesPotential FunctionDetection Method
PhosphorylationSer/Thr residues flanking Myb repeatsModulation of DNA binding affinityPhospho-specific antibodies, Mass spectrometry
AcetylationLys residues in DNA-binding domainAlteration of chromatin interactionAcetylation-specific antibodies, Mass spectrometry
UbiquitinationLys residues throughout proteinRegulation of protein stabilityWestern blot under denaturing conditions
SUMOylationConsensus sequences (ΨKxE)Modulation of protein-protein interactionsSUMO-specific antibodies, SUMO-trap pulldowns

The rapid developmental transitions in Dictyostelium in response to starvation suggest that DdMYB2 activity must be tightly regulated, making PTMs an attractive regulatory mechanism. Future studies employing phospho-proteomics and other PTM-specific analyses would significantly advance our understanding of the temporal control of Myb-like protein function during Dictyostelium development and stress response .

How can researchers address contradictory results between axenic and non-axenic Dictyostelium strains when studying Myb-like proteins?

Contradictory results between axenic and non-axenic strains when studying Myb-like proteins can be addressed through several key strategies. First, recognize that axenic laboratory strains contain mutations affecting Ras signaling and macropinocytosis that may interact with transcription factor-mediated pathways, potentially altering experimental outcomes. Second, implement a comparative approach by conducting parallel experiments in both strain types using the newly developed transfection protocols for non-axenic wild-type cells. Third, if discrepancies are observed, perform epistasis analysis by creating double mutants (e.g., combining Myb mutations with axenic mutations) to understand genetic interactions. Fourth, consider environmental variables - axenic strains grow in liquid media while non-axenic strains grow on bacterial lawns, creating different metabolic conditions that may affect transcription factor activity. Finally, employ single-cell analysis techniques such as reporter gene assays with single-cell resolution to determine if population-level differences mask similar molecular mechanisms. This systematic approach can reveal whether observed differences result from strain background effects or represent genuine biological insights about the context-dependent function of Myb-like proteins .

What statistical approaches are most appropriate for analyzing DdMYB2-dependent gene expression data?

When analyzing DdMYB2-dependent gene expression data, several statistical approaches are particularly appropriate:

  • For RNA-seq data comparing wild-type and DdMYB2-null mutants, employ negative binomial distribution models (as implemented in DESeq2 or edgeR) rather than assuming normal distribution, as count data from sequencing experiments typically show overdispersion.

  • Implement time-course analysis methods when examining developmental gene expression, as DdMYB2 regulates early developmental transitions. Tools like maSigPro or ImpulseDE2 can identify genes with different temporal expression patterns between wild-type and mutant strains.

  • Use appropriate multiple testing correction (Benjamini-Hochberg procedure) to control false discovery rate rather than family-wise error rate (Bonferroni), balancing stringency with discovery potential.

  • Account for batch effects and biological replicates in experimental design and analysis. When technical replicates are used, they should be averaged or treated as a random model term to avoid inflation of degrees of freedom.

  • For integrating ChIP-seq with expression data to identify direct targets, implement statistical methods that can analyze the association between binding events and expression changes, such as the binding and expression target analysis (BETA) algorithm.

These approaches minimize spurious correlations while identifying genuine DdMYB2-regulated genes, providing a robust foundation for understanding this transcription factor's biological role .

Why might attempts to express recombinant Dictyostelium Myb-like proteins result in insoluble or non-functional protein?

Expression of recombinant Dictyostelium Myb-like proteins often encounters challenges resulting in insoluble or non-functional products. Several factors contribute to these issues:

  • Codon bias: Dictyostelium has a highly AT-rich genome (approximately 77% AT content), creating significant codon bias differences with common expression hosts like E. coli. Using codon-optimized constructs or specialized E. coli strains (like Rosetta) can mitigate this problem.

  • Improper folding: Myb domains contain three alpha-helices that form a specific tertiary structure around a hydrophobic core. Expression at high temperatures or high induction levels often leads to misfolding and aggregation. Lower temperature induction (16-18°C) and co-expression with chaperones (GroEL/GroES) can improve folding.

  • Missing post-translational modifications: Functional activity may depend on modifications absent in bacterial systems. For proteins requiring eukaryotic modifications, consider expression in Dictyostelium itself or other eukaryotic systems like insect cells.

  • Incomplete domain boundaries: Improperly defined domain boundaries can expose hydrophobic regions normally buried in the full-length protein. Performing multiple construct designs with varying N- and C-terminal boundaries can identify stable, soluble fragments.

  • Need for binding partners: Some Myb proteins function as part of complexes and may be unstable in isolation. Co-expression with known or predicted interaction partners can enhance solubility and functionality.

Systematically addressing these factors through optimization of expression conditions and construct design can significantly improve the yield of functional recombinant Dictyostelium Myb-like proteins .

How might CRISPR/Cas9 technology advance the study of Dictyostelium Myb-like proteins?

CRISPR/Cas9 technology offers transformative potential for advancing research on Dictyostelium Myb-like proteins through several innovative applications. First, precise genome editing allows creation of point mutations in functional domains (e.g., individual Myb repeats) rather than complete gene knockouts, enabling structure-function studies of specific protein regions. Second, CRISPR interference (CRISPRi) and CRISPR activation (CRISPRa) systems could provide temporal control over Myb gene expression, allowing researchers to manipulate these transcription factors at specific developmental stages. Third, fluorescent tagging of endogenous Myb proteins through CRISPR-mediated knock-in preserves native expression patterns, overcoming artifacts associated with overexpression systems. Fourth, multiplexed CRISPR approaches could simultaneously target multiple Myb family members to address functional redundancy questions. Finally, CRISPR-based screens could identify synthetic lethal interactions with Myb genes, revealing unexpected pathway connections. As Dictyostelium genetic tools continue to evolve, adapting CRISPR methodologies to this model organism's unique genomic features and developmental characteristics will significantly enhance our understanding of Myb-like protein function in fundamental cellular processes .

What insights might comparative studies of Myb-like proteins across evolutionary diverse organisms provide?

Comparative studies of Myb-like proteins across evolutionarily diverse organisms could provide several profound insights:

  • Evolutionary conservation patterns: By comparing Dictyostelium Myb domains with those from other organisms ranging from yeast to humans, researchers could identify highly conserved residues that likely serve critical functions, distinguished from lineage-specific adaptations. This evolutionary signature analysis might reveal previously unrecognized functional motifs.

  • Functional diversification: Dictyostelium possesses multiple Myb-like proteins (including DdMYB2 and DdMyb1) with distinct functions. Comparative analysis could reveal how Myb transcription factors diversified from a common ancestor to regulate different processes across species.

  • Co-evolution with target genes: Tracking the evolution of Myb proteins alongside their target genes across species could reveal how transcriptional networks rewire while maintaining core functions. For instance, while DdMYB2 regulates adenylyl cyclase (ACA) in Dictyostelium, identifying analogous regulatory relationships in other organisms might uncover fundamental signaling principles.

  • Structural insights: Comparing three-dimensional structures of Myb domains across species could illuminate the molecular basis for DNA-binding specificity and interaction with co-factors, potentially guiding the design of specific inhibitors or activators.

  • Novel therapeutic targets: As Dictyostelium contains orthologs of DNA repair pathways relevant to human disease, comparative studies might identify conserved Myb-regulated processes that could serve as therapeutic targets for conditions like cancer or developmental disorders.

This evolutionary perspective would place Dictyostelium Myb proteins in a broader context, highlighting both conserved mechanisms and unique adaptations that contribute to this organism's distinctive biology .

How could single-cell technologies enhance our understanding of Myb-like protein function in Dictyostelium development?

Single-cell technologies offer revolutionary potential for understanding Myb-like protein function in Dictyostelium development by revealing cellular heterogeneity obscured in population studies. Single-cell RNA sequencing (scRNA-seq) could identify distinct transcriptional states among seemingly homogenous cells during early development, potentially revealing if DdMYB2 activation occurs stochastically or in coordinated waves. This technology could also determine if cells exhibit different responsiveness to starvation signals based on their pre-existing transcriptional state. Single-cell ATAC-seq could map chromatin accessibility changes mediated by Myb proteins at unprecedented resolution, revealing how these transcription factors reorganize the epigenetic landscape during development. Live-cell imaging combined with fluorescent reporters for Myb activity could track transcription factor dynamics in real-time during multicellular aggregation, connecting molecular events to morphological changes. Spatial transcriptomics could map Myb activity within developing structures, potentially identifying localized signaling centers. Finally, combining these technologies with perturbation approaches (CRISPR, optogenetics) would enable causal relationships to be established between Myb activity and cell fate decisions. These approaches would transform our understanding of how transcription factors like DdMYB2 coordinate multicellular development from a population-averaged view to a spatiotemporally resolved, mechanistic model .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.