Recombinant Dictyostelium discoideum NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 (ndufa13)

Shipped with Ice Packs
In Stock

Description

Biological Role of NDUFA13

NDUFA13 is a core accessory subunit of mitochondrial Complex I (NADH:ubiquinone oxidoreductase), which catalyzes electron transfer from NADH to ubiquinone, coupled with proton pumping across the mitochondrial inner membrane . While not directly involved in catalysis, it stabilizes the complex and ensures proper assembly . In D. discoideum, homologs of human mitochondrial proteins are well-conserved, as shown by proteomic studies identifying 1,451 mitochondrial proteins, including ETC components .

Key Functional Features:

  • Electron Transport: Facilitates NADH oxidation and ubiquinone reduction, critical for ATP synthesis .

  • Structural Stabilization: Anchors peripheral and transmembrane domains of Complex I .

  • Apoptotic Regulation: Human NDUFA13 (GRIM-19) interacts with STAT3 to regulate cell death pathways .

Table 1: Comparative Features of NDUFA13

FeatureHuman NDUFA13 D. discoideum Homolog
Molecular Weight~17 kDaPredicted ~18 kDa
Gene LocationChromosome 19p13.2Chromosome 2 (hypothetical)
Complex I RoleAccessory subunitAccessory subunit (inferred)
Interacting PartnersSTAT3Orthologs of STAT-like proteins
Pathogenic RelevanceLinked to Crohn’s disease Mitochondrial dysfunction models

Expression and Purification

  • Cloning: Likely uses AX2 strain vectors (e.g., pDM304) for constitutive expression under actin promoters .

  • Localization: Predicted mitochondrial targeting via N-terminal presequences .

  • Functional Assays: Mitochondrial respirometry and ROS measurements, as demonstrated for AIF (apoptosis-inducing factor) in D. discoideum .

Research Applications

Recombinant NDUFA13 enables mechanistic studies of:

  • Complex I Dysfunction: Mitochondrial diseases linked to ETC defects (e.g., Leigh syndrome) .

  • Host-Pathogen Interactions: D. discoideum is used to study bacterial resistance and phagocytosis, where mitochondrial energetics modulate immune responses .

  • Autophagy Regulation: D. discoideum autophagy mutants (e.g., atg1−) show altered mitochondrial dynamics, suggesting NDUFA13’s role in stress adaptation .

Table 2: Experimental Findings from Related Studies

Study FocusKey ResultRelevance to NDUFA13
Mitochondrial RespirationAIF knockdown reduces ETC activity Supports NDUFA13’s structural role
Proteomic Profiling328 proteins enriched in D. discoideum mitochondria Confirms ETC conservation
STAT3 InteractionHuman NDUFA13 inhibits STAT3 signaling Suggests conserved regulatory pathways

Challenges and Future Directions

  • Functional Redundancy: D. discoideum’s genome encodes multiple ETC isoforms, complicating knockout studies .

  • Structural Insights: Cryo-EM of recombinant Complex I could resolve assembly mechanisms .

  • Therapeutic Screening: D. discoideum models enable high-throughput drug testing for mitochondrial disorders .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we currently have in stock. However, if you have specific requirements for the format, please indicate them in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot the protein for multiple uses to minimize freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
ndufa13; DDB_G0274311; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-113
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
Target Protein Sequence
MVGYRQKWVQDLPPAGGFPKLKYARTSTSPIPGAYIFAGVFSIMAVGTYIFFSDKVERNA REEEEKRRLSMILPILQAENDINFLASPHQNVYFTRWMPPQTGKRAAALLRDL
Uniprot No.

Target Background

Function
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which is believed not to be directly involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is thought to be ubiquinone.
Database Links
Protein Families
Complex I NDUFA13 subunit family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein; Matrix side.

Q&A

How can researchers confirm successful expression of recombinant D. discoideum NDUFA13?

Verification of recombinant NDUFA13 expression can be accomplished through:

  • Western blot analysis using antibodies against affinity tags (similar to the ALFA-tag approach demonstrated with BadA protein in D. discoideum)

  • Running samples under both reducing and non-reducing conditions to evaluate potential disulfide bond formation and protein folding (as observed with BadA)

  • Mass spectrometry identification of purified protein, which would detect specific peptides matching the D. discoideum NDUFA13 sequence

  • Size exclusion chromatography to confirm monomeric state and proper folding

Based on similar proteins in D. discoideum, expect an apparent molecular weight of approximately 17-25 kDa, though this may vary depending on post-translational modifications and experimental conditions .

What expression systems are most suitable for producing recombinant D. discoideum NDUFA13?

When selecting an expression system, consider these methodological approaches:

Table 1: Comparison of Expression Systems for Recombinant D. discoideum NDUFA13

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coliHigh yield, low cost, rapid growthMay not properly fold membrane proteinsUse specialized strains (C41/C43), lower induction temperature (15-20°C), fusion tags (MBP, SUMO)
Yeast (P. pastoris)Eukaryotic folding machinery, post-translational modificationsLonger growth time, more complex mediaMethanol induction optimization, high cell-density fermentation
Insect cellsAdvanced eukaryotic folding, high yield for membrane proteinsHigher cost, technically demandingOptimize MOI, harvest timing, addition of lipids to media
Homologous (D. discoideum)Native cellular environment, proper foldingLower yields, specialized expertise requiredTagged constructs with strong promoters, similar to successful BadA-ALFA expression

For membrane proteins like NDUFA13, homologous expression in D. discoideum itself may provide the most reliable results for functional studies, as demonstrated with the BadA protein system .

What purification strategy yields optimal recovery of functional D. discoideum NDUFA13?

Based on successful purification of other D. discoideum proteins, a multi-step approach is recommended:

  • Initial capture: For acidic proteins in D. discoideum (similar to NDUFA13's expected properties), anion exchange chromatography at pH 3.0 has proven highly effective. This approach successfully purified bacteriolytic proteins in D. discoideum with 90% recovery of activity .

  • Size exclusion chromatography: Further separation based on molecular weight, with active fractions typically eluting with an apparent size between 30-70 kDa (for oligomeric assemblies or detergent-protein complexes) .

  • Affinity purification: If expressing tagged NDUFA13 (similar to BadA-ALFA), immunoprecipitation with tag-specific antibodies can isolate the protein from cleared lysates .

Critical considerations:

  • Maintain protein in appropriate detergent micelles throughout purification

  • Consider the possibility of disulfide bonds stabilizing protein structure (as seen with BadA)

  • Monitor activity throughout purification to ensure functional integrity

  • Verify purity by SDS-PAGE and mass spectrometry

How can researchers assess the functional activity of purified recombinant D. discoideum NDUFA13?

Since NDUFA13 functions as part of Complex I, activity assessment requires approaches that evaluate:

  • Incorporation into Complex I:

    • Reconstitution of purified NDUFA13 with isolated D. discoideum mitochondria depleted of endogenous NDUFA13

    • Blue native PAGE analysis to detect incorporation into the complex

    • Co-immunoprecipitation with other Complex I components

  • Functional assays:

    • NADH:ubiquinone oxidoreductase activity measurements in reconstituted systems

    • Oxygen consumption rate measurements using high-resolution respirometry

    • ROS production assessment using specific fluorescent probes

  • Structural integrity evaluation:

    • Circular dichroism to confirm secondary structure content

    • Thermal shift assays to assess protein stability

    • Limited proteolysis to verify proper folding

A multifaceted approach is necessary as NDUFA13 itself is not catalytic but contributes to Complex I assembly and function.

What experimental approaches can identify protein-protein interactions of D. discoideum NDUFA13?

To map the interactome of NDUFA13 in D. discoideum:

  • Affinity purification coupled with mass spectrometry:

    • Express tagged NDUFA13 in D. discoideum (similar to BadA-ALFA system)

    • Perform gentle cell lysis maintaining native interactions

    • Capture NDUFA13 with anti-tag antibodies

    • Identify co-purifying proteins by mass spectrometry

  • Proximity labeling:

    • Fuse NDUFA13 with BioID or APEX2

    • Biotinylate proteins in close proximity to NDUFA13 in vivo

    • Identify labeled proteins by streptavidin purification and mass spectrometry

  • Cross-linking mass spectrometry:

    • Treat intact mitochondria with membrane-permeable crosslinkers

    • Identify NDUFA13-containing crosslinked peptides

    • Map interaction interfaces at amino acid resolution

Table 2: Expected Interaction Partners of NDUFA13 Based on Complex I Architecture

Protein CategoryExamplesDetection MethodBiological Significance
Core Complex I subunitsNDUFS1, NDUFS2, NDUFS3AP-MS, BN-PAGEStructural integrity of Complex I
Assembly factorsNDUFAF1-6Pulse-chase AP-MSComplex I biogenesis pathway
Regulatory proteinsKinases, phosphatasesProximity labelingPost-translational regulation
Membrane organizationCardiolipin synthase, MICOSXL-MSSupramolecular organization

How can researchers genetically modify D. discoideum to study NDUFA13 function in vivo?

To investigate NDUFA13 function through genetic manipulation:

  • Gene knockout strategies:

    • Homologous recombination with selection markers

    • CRISPR-Cas9 genome editing for precise modifications

    • Conditional knockout systems if complete deletion is lethal

  • Expression of variant forms:

    • Site-directed mutagenesis to introduce specific mutations

    • Fluorescent protein fusions for localization studies

    • Overexpression studies using strong promoters (similar to BadA overexpression)

  • Phenotypic analysis:

    • Mitochondrial function assessment (oxygen consumption, membrane potential)

    • Growth rate under different metabolic conditions

    • Stress response evaluation

    • Phagocytosis and bacterial killing capacity (relevant in D. discoideum)

For phenotypic characterization, consider that alterations in NDUFA13 may affect phagosome function, as demonstrated by the reduced bacteriolytic activity in extracts from kil1 KO D. discoideum cells, suggesting connections between mitochondrial function and phagocytic pathways .

What are the methodological challenges in determining the structure of D. discoideum NDUFA13?

Structural characterization presents several challenges:

  • Expression and purification barriers:

    • Obtaining sufficient quantities of pure, homogeneous protein

    • Maintaining stability throughout purification

    • Selecting appropriate detergents or membrane mimetics

  • Structural biology approaches:

    • X-ray crystallography: Challenging for membrane proteins, requires stable crystal formation

    • Cryo-EM: May require incorporation into larger complexes for adequate size

    • NMR spectroscopy: Limited by protein size and requires isotope labeling

  • Computational considerations:

    • Homology modeling based on human NDUFA13 structure

    • Molecular dynamics simulations to predict behavior in membrane environments

    • Integration of experimental constraints with computational predictions

For membrane proteins like NDUFA13, structural information might best be obtained by studying it within the context of the entire Complex I, similar to approaches used for human respiratory complexes.

How can researchers develop specific antibodies against D. discoideum NDUFA13?

Developing specific antibodies requires:

  • Antigen design strategies:

    • Recombinant full-length protein in detergent micelles

    • Synthetic peptides from hydrophilic domains (preferably C-terminal region)

    • Fusion proteins containing the hydrophilic domain

  • Production methodology:

    • Monoclonal antibody development using hybridoma technology

    • Polyclonal antibodies with affinity purification against the immunizing antigen

    • Recombinant antibody fragments (scFv, nanobodies) from synthetic libraries

  • Validation experiments:

    • Western blot against recombinant protein and D. discoideum extracts

    • Immunoprecipitation followed by mass spectrometry

    • Immunofluorescence microscopy to confirm mitochondrial localization

    • Testing in NDUFA13-knockout cells as negative control

For D. discoideum proteins, consider that the acidic cellular environment may influence epitope selection and antibody performance in certain applications .

How might studying D. discoideum NDUFA13 inform our understanding of mitochondrial Complex I evolution?

D. discoideum occupies an important evolutionary position for comparative studies:

  • Evolutionary insights:

    • D. discoideum diverged after yeast but before metazoans, providing an intermediate evolutionary perspective

    • Comparison of NDUFA13 sequence, structure, and function across species reveals evolutionary constraints

    • Identification of conserved residues highlights functionally critical regions

  • Methodological approach:

    • Multiple sequence alignment of NDUFA13 orthologs across species

    • Phylogenetic tree construction to map evolutionary relationships

    • Structure-based comparison of binding interfaces

    • Functional complementation studies across species

  • Ancestral function examination:

    • D. discoideum may reveal primordial functions of NDUFA13 before additional roles evolved in higher organisms

    • Investigation of potential roles beyond respiration, such as in the bactericidal activity observed in D. discoideum phagosomes

What is the relationship between NDUFA13 and the bacteriolytic activities discovered in D. discoideum?

This question explores a potential connection between mitochondrial proteins and bacteriolytic functions:

  • Current evidence:

    • D. discoideum exhibits bacteriolytic activity against K. pneumoniae at acidic pH (similar to phagosomal conditions)

    • This activity depends on proteins like BadA, which contains a DUF3430 domain

    • Mitochondrial proteins can be repurposed for immune functions in various organisms

  • Experimental approaches to test connection:

    • Co-localization studies of NDUFA13 and bacteriolytic proteins in phagosomes

    • Evaluation of bacteriolytic activity in NDUFA13-depleted cells

    • Investigation of potential physical interactions between NDUFA13 and Bad proteins

    • Assessment of whether NDUFA13 itself has bacteriolytic activity at acidic pH

  • Evolutionary hypothesis:

    • Both mitochondria and phagosomes represent specialized membrane compartments with distinct pH environments

    • Proteins may have evolved dual functions in these compartments

    • The acidic environment of both phagosomes and mitochondrial intermembrane spaces may have selected for proteins with similar properties

How does recombinant D. discoideum NDUFA13 compare with human NDUFA13 in structure-function studies?

Comparative analysis provides valuable insights:

Table 3: Comparative Analysis of Human and D. discoideum NDUFA13

FeatureHuman NDUFA13D. discoideum NDUFA13Methodological Considerations
Size17 kDa, 144 amino acids Predicted similar sizeWestern blot with size comparison
StructureL-shaped, transmembrane domain plus hydrophilic domain Likely conservedCircular dichroism, limited proteolysis
Membrane topologyN-terminal membrane anchor Predicted similarProtease protection assays
Complex I integrationAccessory subunit Predicted similarBlue native PAGE
Post-translational modificationsVarious phosphorylation sitesUnknownMass spectrometry analysis
pH sensitivityFunctions at physiological pHMay function in acidic environmentsActivity assays across pH range

This comparative approach identifies conserved features essential for fundamental function versus species-specific adaptations that reflect unique biological contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.