Recombinant Dictyostelium discoideum NADH-ubiquinone oxidoreductase chain 3 (nad3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
nad3; DDB_G0294022; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
nad3
Target Protein Sequence
MGVTFEFVYILVLLAISTGLSVILFFLGYFLMFKVAYEDKLMGYECGFDPFGNARGEFDI RFYLVAILFLIFDLEITFLFPFSVSIMSMTLLSYSLMLIFLIILTIGFIYEIKKGALDWS
Uniprot No.

Target Background

Function

Recombinant Dictyostelium discoideum NADH-ubiquinone oxidoreductase chain 3 (NAD3): A core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It's considered part of the minimal assembly essential for catalytic activity. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is the significance of nad3 in D. discoideum mitochondrial biology?

NADH-ubiquinone oxidoreductase chain 3 (nad3) is a core component of mitochondrial respiratory Complex I in Dictyostelium discoideum. Unlike many other eukaryotes where some Complex I components have been transferred to the nuclear genome, D. discoideum retains nad3 in its mitochondrial DNA, preserving an ancestral characteristic that makes it valuable for evolutionary studies . This maintenance of nad3 in the mitochondrial genome is consistent with the Dictyosteliaceae having diverged from other eukaryotes at an early stage, prior to the gene transfer events that occurred in the lineage leading to plants and animals . Notably, the D. discoideum mitochondrially encoded nad3 shows approximately twice the mutation rate compared to homologous genes in other eukaryotes, making it the most divergent eukaryotic form of this protein .

D. discoideum nad3 functions as part of Complex I (NADH:ubiquinone oxidoreductase), which catalyzes electron transfer from NADH to ubiquinone while pumping protons across the inner mitochondrial membrane, contributing to the proton gradient needed for ATP synthesis . The protein typically contains multiple transmembrane helices that anchor it within the inner mitochondrial membrane.

How does D. discoideum serve as a model for mitochondrial research?

D. discoideum has emerged as a powerful model for studying mitochondrial genetics and bioenergetics for several reasons:

  • It possesses a uniquely large mitochondrial genome (approximately 54 kb) compared to most metazoan mitochondrial genomes

  • It exhibits apparent use of the universal genetic code in its mtDNA, unlike most non-plant mtDNA where TGA codes for tryptophan

  • It retains primitive genes that are nuclear-encoded in higher organisms

  • It has a well-characterized life cycle with both unicellular and multicellular stages

  • It shows high conservation of essential mitochondrial functions relevant to human disease

The social amoeba's experimental tractability has enabled the creation of a comprehensive mitochondrial protein compendium consisting of 936 proteins . Nearly one-third of D. discoideum mitochondrial proteins lack homologs in human mitochondria, suggesting significant divergence between these proteomes and potentially unique mitochondrial functions in this organism .

What methods are most effective for recombinant expression of D. discoideum nad3?

Recombinant expression of D. discoideum nad3 presents unique challenges due to its mitochondrial origin and hydrophobic nature. Effective approaches include:

MethodAdvantagesLimitationsConsiderations
E. coli expression systemsHigh yield, simplicityPotential misfolding, lack of post-translational modificationsRequires codon optimization, use of specialized vectors (pET series)
Yeast expression systemsEukaryotic processing, membrane protein handlingLower yield than bacterial systemsMitochondrial targeting sequences needed
D. discoideum expressionNative environment, proper foldingTechnical complexityEnables study in natural cellular context
Cell-free systemsAvoids toxicity issuesHigher cost, lower yieldUseful for initial characterization

For functional studies, expression in D. discoideum itself offers advantages as the protein will be targeted to mitochondria and potentially incorporated into native Complex I. This approach requires vectors with appropriate selection markers and can be verified through techniques such as mitochondrial isolation followed by Western blotting or enzyme activity assays .

How can researchers effectively isolate and characterize mitochondria from D. discoideum?

Efficient isolation and characterization of D. discoideum mitochondria requires specialized protocols:

  • Cell lysis: Gentle disruption methods (nitrogen cavitation or Dounce homogenization) in isotonic buffers containing protease inhibitors

  • Differential centrifugation: Low-speed centrifugation to remove unbroken cells and nuclei, followed by higher-speed centrifugation to pellet mitochondria

  • Density gradient purification: Further purification using Percoll or sucrose gradients

  • Quality assessment: Measuring respiratory control ratios, citrate synthase activity, and monitoring mitochondrial membrane potential

For functional characterization of nad3 within isolated mitochondria, researchers can measure:

  • Complex I activity through NADH:ubiquinone oxidoreductase assays

  • Oxygen consumption using high-resolution respirometry

  • Mitochondrial membrane potential using fluorescent probes

  • ROS production with specific indicators

The proteomic approach validated through mitochondrial targeting sequence prediction and live-cell imaging has proven effective in generating comprehensive mitochondrial protein inventories in D. discoideum .

What approaches are most effective for studying nad3 mutations in D. discoideum?

Studying nad3 mutations in D. discoideum requires specialized approaches due to its mitochondrial localization:

  • Site-directed mutagenesis: Introduction of specific mutations to study structure-function relationships

  • Heteroplasmy analysis: Quantifying wild-type versus mutant mitochondrial DNA copies

  • Phenotypic characterization: Assessing effects on growth, development, and multicellular organization

  • Complementation studies: Testing rescue with wild-type nad3 expression

  • Inverse PCR techniques: For identifying insertion sites in mutant strains

Mutations in mitochondrial genes like nad3 have been shown to impair multicellular development in D. discoideum, suggesting that mitochondrial function is essential for initiating the developmental program . For example, deletion of the rnl locus (encoding mt-ribosomal protein S4) impairs aggregation and slug phototaxis without affecting vegetative growth .

How does heterogeneity in nad3 contribute to mitochondrial function in D. discoideum?

Recent research has revealed interesting patterns of heterogeneity in nad genes in D. discoideum and related organisms:

  • Mitochondrial genome analysis shows that nad5, similar to cox1, can exhibit heterogeneous variants

  • The number of heterogeneous types (HTs) in nad5 ranges from 6-8 per sample, with sizes varying from 600bp to 2558bp

  • Different copies of nad genes show heterogeneity, with different HTs having different copy numbers

  • Evidence suggests potential heteroplasmic loci may be present in multiple mitochondrial genes

This heterogeneity may contribute to metabolic flexibility and adaptation to different environmental conditions. Some specimens show inserted copies of nad5 between different heterogeneous types of cox1, and in certain cases, the 5' end of heterogeneous fragments of nad5 coincides with the 3' end sequence of nad4L . The functional significance of this genetic diversity remains an active area of investigation.

How does D. discoideum nad3 compare to its homologs in other organisms?

Comparative analysis reveals significant differences between D. discoideum nad3 and its homologs:

  • D. discoideum maintains nad3 in its mitochondrial genome, while in many metazoans, some Complex I components have been transferred to the nuclear genome

  • The mutation rate is approximately twofold higher compared to homologous genes in other eukaryotes

  • The protein is one of the most divergent eukaryotic forms of this Complex I subunit

  • The mitochondrial genome of D. discoideum uses the universal stop codon TGA, which codes for tryptophan in nearly all non-plant mtDNA

Phylogenomic reconstruction indicates that the mitochondrial ancestor was likely capable of respiration under low oxygen conditions, with genes like nad3 playing important roles in this process . The evolutionary conservation of Complex I function makes insights from D. discoideum potentially translatable to human disease contexts, particularly for understanding disorders associated with mitochondrial dysfunction .

What insights does D. discoideum nad3 provide about mitochondrial genome evolution?

D. discoideum nad3 offers valuable perspectives on mitochondrial evolution:

  • The large mitochondrial genome (54 kb), lack of intergenic sequence, and apparent use of the universal genetic code suggest D. discoideum mtDNA may encode many primitive genes that are nuclear-encoded in higher organisms

  • The retention of genes like nad3 in the mitochondrial genome provides clues about the selective pressures governing gene transfer from mitochondria to the nucleus

  • The sequence and structure of nad3 and other Complex I components help reconstruct the evolutionary trajectory of mitochondria from their bacterial endosymbiont ancestors

  • The high mutation rate in D. discoideum nad3 may reflect relaxed selection pressure or unique mechanisms of DNA repair in this organism's mitochondria

Phylogenomic analysis places mitochondria within the Rickettsiales order, as a sister clade to several bacterial families, with evidence suggesting that pre-mitochondria were capable of oxidative phosphorylation under low oxygen conditions .

How can D. discoideum nad3 research contribute to understanding human mitochondrial diseases?

D. discoideum has emerged as a valuable model for investigating mitochondrial diseases for several reasons:

  • Mitochondrial diseases in D. discoideum present consistent, measurable readouts of dysregulated intracellular signaling pathways

  • When genetic defects produce generalized deficiencies in multiple respiratory complexes, disease phenotypes are mediated by chronic activation of AMP-activated protein kinase (AMPK)

  • The model allows for investigation of the functional consequences of mutations equivalent to those found in human MT-ND3

  • It provides a platform for testing potential therapeutic compounds that could modulate Complex I activity

Research has shown that in D. discoideum, chronic AMPK hyperactivity maintains mitochondrial mass and cellular ATP concentrations at normal levels but impairs growth, cell cycle progression, and multicellular development . This finding provides insights into how cells compensate for mitochondrial dysfunction, which has implications for understanding human mitochondrial disorders.

What is the role of nad3 in D. discoideum development and multicellular organization?

Nad3, as part of Complex I, plays critical roles in D. discoideum development:

  • During the transition from unicellular to multicellular stages, energy demands change significantly, requiring proper function of respiratory complexes

  • Mitochondrial respiration appears to increase at the beginning of starvation, suggesting a crucial role for nad3 and other respiratory components in initiating the developmental program

  • Pharmacological inhibition of either Complex I or Complex V can induce aggregation, demonstrating a complex relationship between mitochondrial function and development

  • Mutants with impaired mitochondrial function show aberrant fruiting body morphology and defects in phototaxis and thermotaxis

The energy produced through nad3's role in Complex I is critical for the cAMP signaling that coordinates multicellular development in D. discoideum. Research has shown that mitochondrial disease phenotypes in this organism can include impaired phototaxis, thermotaxis, and phagocytosis, providing measurable readouts of mitochondrial dysfunction .

How can CRISPR/Cas9 and other genetic engineering tools be applied to study nad3 function?

While directly editing mitochondrial DNA remains challenging, several approaches can be employed:

  • Creating nuclear-encoded, mitochondrially-targeted versions of nad3 that can be manipulated with CRISPR/Cas9

  • Using CRISPR to edit nuclear genes encoding Complex I assembly factors or interacting partners

  • Developing mitochondrially-targeted base editors or prime editors

  • Creating reporter systems to monitor nad3 expression and mitochondrial function

  • Employing RNA interference or antisense technologies to modulate expression of genes affecting nad3 function

These approaches could provide new insights into nad3 biology that were previously difficult to obtain through traditional genetic methods. The genetic tractability of D. discoideum makes it particularly suitable for such advanced genetic manipulation strategies .

What omics approaches are most informative for studying nad3 in the context of the mitochondrial proteome?

Integrated omics approaches offer comprehensive insights into nad3 function:

  • Proteomics: High-throughput multiplexed protein quantitation has been successfully used to generate a high-confidence mitochondrial protein compendium in D. discoideum

  • Transcriptomics: RNA-seq can reveal coordination between nuclear and mitochondrial gene expression

  • Metabolomics: Analysis of metabolic changes in nad3 mutants can reveal downstream effects on cellular metabolism

  • Interactomics: Techniques like BioID or APEX proximity labeling can map the protein interaction network of nad3

  • Comparative genomics: Analysis across species can identify conserved functional domains and regulatory elements

A recent study combined mass spectrometry with mathematical modeling to identify 936 high-confidence mitochondrial proteins in D. discoideum, validating this approach through mitochondrial targeting sequence prediction and live-cell imaging . Similar strategies could be applied to specifically study nad3 and its interaction partners.

How can D. discoideum nad3 research inform development of treatments for mitochondrial disorders?

Research on D. discoideum nad3 has translational implications:

  • As a screening platform for compounds that rescue Complex I deficiency

  • For understanding compensatory mechanisms that maintain ATP levels despite respiratory chain defects

  • To investigate the role of AMPK signaling in mitochondrial disease, which could lead to novel therapeutic targets

  • For studying the effects of potential therapeutic interventions on mitochondrial function in a tractable model system

  • To identify biomarkers of mitochondrial dysfunction that might be applicable to human diseases

The NAD3® supplementation study, while not directly related to nad3 protein, demonstrates how interventions targeting NAD+ metabolism can affect stem cell mobilization and potentially have therapeutic implications for age-related declines in stem cell function . This illustrates the broader importance of understanding NADH-related pathways in cellular health.

What role might nad3 play in aging and age-related diseases?

The relationship between nad3, mitochondrial function, and aging processes includes:

  • Mitochondrial dysfunction is a hallmark of aging, and nad3 function is critical for maintaining proper respiratory chain activity

  • D. discoideum can serve as a model for studying how nad3 mutations might contribute to age-related mitochondrial decline

  • Research on NAD+ metabolism (related to nad3 function) shows potential effects on stem cell populations and regenerative processes

  • The role of nad3 in regulating reactive oxygen species production connects it to oxidative stress theories of aging

  • Understanding nad3 function may provide insights into neurodegenerative diseases with mitochondrial involvement

A recent study on NAD3® supplementation demonstrated effects on circulating adult stem cell numbers, suggesting potential applications in addressing age-related declines in stem cell function . While this supplement is distinct from the nad3 protein, it highlights the importance of NAD-related pathways in aging biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.