Recombinant Dictyostelium discoideum P2X receptor D (p2xD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping is available upon request with an additional charge; please contact us in advance.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
p2xD; DDB_G0288335; P2X receptor D; P2XD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-407
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
p2xD
Target Protein Sequence
MDWDNIFSYNTAKIVTIKDRRLGGLHIIFMVLIIVYIVIYSTIYKKGYLLTETPVGSIRA SLLAPNEFKDDSNFKYCDDNLIEYNFTKLECDYYDEAFVSFPVGDDVSFAVTTRVKTLDQ VLNCSSKNPKCKYTTVSTRNVYVSDIEDFTILIDHTMFAPSSLIQYNSKQLKGYILDNDN NEIQINETINTVGIPGKPDILTIGKLLQLANIDLDGASSVNSTNSVRYDGVVALVFITYS NTFSYNTNNFKYVYSIQKVEDTEYGVPEAVILDNVSSRMYYNRHGIRLIFIQNGEIGSFN FQALLLTFVSGLGLLAISTVLVDQLAIRFLPERKTYSSHKFQITHGFSESRNKLRISQNE KDPLLLVETTKNNENNNNNDDYNDDDNEIFDDNNNGYQNIQNNNIIL
Uniprot No.

Target Background

Function

P2X receptors are ATP-gated ion channels involved in intracellular calcium signaling. It is noteworthy that ATP does not induce inward currents in p2xD. This receptor is not essential for osmoregulation.

Database Links
Protein Families
P2X receptor family
Subcellular Location
Contractile vacuole membrane. Note=Ligand binding domain within the lumen of the vacuole.

Q&A

What is the Dictyostelium discoideum P2X receptor D (p2xD) and how does it compare to other P2X receptors?

P2XD is one of five P2X receptor homologs (P2XA, P2XB, P2XC, P2XD, and P2XE) identified in the Dictyostelium discoideum genome. Unlike vertebrate P2X receptors that function at the plasma membrane, Dictyostelium P2X receptors are primarily localized to intracellular membranes, specifically the contractile vacuole complex, which is involved in osmoregulation. P2XD forms functional ATP-activated ion channels, similar to P2XA, P2XB, and P2XE, while P2XC appears to be non-functional as an ATP-gated channel .

What is the subcellular localization of p2xD and how does this relate to its function?

P2XD, like other Dictyostelium P2X receptors, is predominantly localized to the membranes of the contractile vacuole complex rather than the plasma membrane. This specialized osmoregulatory organelle allows protists like Dictyostelium to survive in hypotonic environments such as soil and fresh water . The intracellular localization of p2xD contrasts with the plasma membrane expression observed in vertebrate P2X receptors and suggests an adaptation for internal osmoregulatory functions rather than external signaling .

What is the physiological role of p2xD in Dictyostelium discoideum?

P2XD plays a crucial role in osmoregulation in Dictyostelium discoideum. Studies have shown that P2XD can rescue the regulatory volume decrease defect in P2XA-deficient cells, demonstrating functional significance in the contractile vacuole system .

The contractile vacuole is essential for amoebae to survive in hypotonic environments, as it collects excess water and expels it from the cell. P2XD contributes to this process, likely by facilitating ion fluxes that are necessary for proper contractile vacuole function. Experimental evidence indicates that P2XD is among the most effective of the Dictyostelium P2X receptors at rescuing the osmoregulatory phenotype when P2XA is absent, suggesting a significant physiological role in this process .

What are the key biophysical properties of recombinant p2xD ion channels?

Recombinant p2xD forms ATP-gated ion channels with distinct biophysical properties. When expressed in heterologous systems like HEK293 cells, p2xD exhibits:

  • ATP sensitivity in the micromolar range, similar to vertebrate P2X receptors

  • Cation selectivity with permeability to both monovalent and divalent cations

  • Distinct desensitization kinetics that are modulated by pH and ionic conditions

  • Inhibition by extracellular sodium (compared to potassium)

  • Decreased current amplitude at acidic pH (pH 6.2), contrasting with P2XB and P2XE which show enhanced currents in acidic conditions

These properties suggest that p2xD has evolved specialized characteristics suited to its function in the intracellular environment of the contractile vacuole, where ionic conditions differ from the extracellular environment normally experienced by vertebrate P2X receptors .

How does extracellular pH affect p2xD channel function compared to other Dictyostelium P2X receptors?

The effect of pH on p2xD channel function reveals important differences between the Dictyostelium P2X receptor subtypes:

P2X ReceptorEffect of Acidic pH (pH 6.2)Functional Implication
P2XAAccelerated desensitizationReduced sustained activity in acidic environments
P2XBIncreased current amplitudeEnhanced activity in acidic environments
P2XDDecreased current amplitudeReduced activity in acidic environments
P2XEIncreased current amplitudeEnhanced activity in acidic environments

These differential pH sensitivities suggest that the various P2X receptors in Dictyostelium may be optimized for different microenvironments within the contractile vacuole system or may function at different stages of the osmoregulatory cycle. The reduced activity of p2xD at acidic pH may indicate its preferential function in more neutral compartments of the contractile vacuole or during specific phases of the fill/discharge cycle .

How do ionic conditions influence p2xD receptor function?

P2XD receptor function is strongly modulated by the ionic environment. A notable characteristic of p2xD is its inhibition by extracellular sodium compared to potassium, a property it shares with P2XB and P2XE receptors. This sodium sensitivity contrasts with most vertebrate P2X receptors and likely reflects adaptation to the unique ionic environment of the contractile vacuole.

The sensitivity to ionic conditions may be physiologically relevant, as the contractile vacuole undergoes dynamic changes in ion composition during its filling and emptying cycles. These properties suggest that p2xD activity may be regulated by changing ion concentrations during the osmoregulatory process, potentially serving as a feedback mechanism to coordinate vacuole function .

What expression systems are most effective for producing functional recombinant p2xD?

Expressing functional recombinant p2xD requires careful consideration of expression systems and conditions:

For studies requiring native environment expression, transformation of Dictyostelium cells by electroporation followed by G418 selection has been effective for generating stable cell lines expressing fluorescently tagged p2xD .

What electrophysiological approaches are most suitable for characterizing p2xD channel function?

Several electrophysiological techniques have been employed to characterize p2xD channel function:

  • Whole-cell patch clamp: This approach allows measurement of macroscopic currents and determination of concentration-response relationships for ATP and other potential agonists. For p2xD, typical experiments use ATP concentrations ranging from 10-300 μM .

  • Outside-out patch recordings: This configuration enables the study of single-channel properties, including conductance (approximately 8 pS at -100 mV for related Dictyostelium P2X receptors) and open probability .

  • Ion substitution experiments: By measuring current reversal potentials in different extracellular ions, relative permeability can be determined. This approach has revealed that Dictyostelium P2X receptors, like vertebrate P2X receptors, are permeable to Ca²⁺ and other cations .

  • pH and ionic modulation: Given the sensitivity of p2xD to pH and ionic conditions, experiments should include careful control of these parameters, testing responses at different pH values (e.g., pH 6.2 vs. pH 7.4) and in sodium versus potassium-based solutions .

How can the osmoregulatory function of p2xD be assessed in Dictyostelium cells?

The osmoregulatory function of p2xD can be assessed through several complementary approaches:

  • Regulatory volume decrease (RVD) assays: Expose cells to hypotonic conditions and measure changes in cell volume over time (typically 40-60 minutes). Wild-type cells initially swell by approximately 20% but then undergo regulatory volume decrease, whereas cells lacking functional P2X receptors continue to swell .

  • Rescue experiments: Express p2xD in P2XA-deficient Dictyostelium cells and assess restoration of normal RVD. This approach has demonstrated that p2xD can effectively rescue the osmoregulatory defect of P2XA-null cells .

  • Contractile vacuole dynamics: Visualize contractile vacuole function using phase contrast microscopy or fluorescent markers. Measure the frequency and efficiency of contractile vacuole emptying in response to hypotonic challenge .

  • Pharmacological intervention: Use copper ions (Cu²⁺) at nanomolar concentrations, which block Dictyostelium P2X receptors, to pharmacologically mimic the phenotype of receptor-deficient cells .

  • Subcellular localization: Confirm proper localization of fluorescently tagged p2xD to contractile vacuole membranes using co-localization with established markers such as calmodulin .

How does the ATP binding site of p2xD compare to vertebrate P2X receptors?

The ATP binding site of p2xD shows both conservation and divergence compared to vertebrate P2X receptors:

  • Conserved elements: Some critical lysine residues important for ATP binding in vertebrate P2X receptors are conserved in Dictyostelium p2xD, suggesting fundamental similarities in ATP recognition.

  • Divergent features: Several amino acid residues now known to be critically involved in binding the γ-phosphate of ATP in vertebrate receptors are absent in most Dictyostelium sequences, including p2xD .

  • Agonist selectivity: Despite these differences, ATP remains the preferred agonist for p2xD, with other nucleotides showing limited effectiveness. This suggests that while the binding site architecture may differ, the functional outcome remains similar .

The differences in the ATP binding site between p2xD and vertebrate P2X receptors may reflect evolutionary adaptations to the intracellular environment of the contractile vacuole, where ATP concentrations and ionic conditions differ from the extracellular milieu of higher organisms .

What critical residues determine the functional properties of p2xD?

Several key residues determine the functional properties of p2xD, as identified through site-directed mutagenesis and functional studies of related Dictyostelium P2X receptors:

  • ATP binding: Lysine residues equivalent to K67 and K289 in P2XA are crucial for ATP sensitivity. Mutation of the equivalent of K67 to alanine causes a greater than tenfold decrease in ATP sensitivity, while mutation of K289 drastically reduces current amplitude .

  • Channel function: An aspartate residue in the second transmembrane domain (equivalent to D330 in P2XA) is essential for channel function, similar to vertebrate P2X receptors .

  • Receptor stability: The C-terminal YXXXK motif found in vertebrate P2X receptors is also required in Dictyostelium P2X receptors for robust membrane expression and function .

Interestingly, some regions that are critical in mammalian P2X receptors are not essential in Dictyostelium receptors, including the conserved NFTΦΦΦKNSΦ and GYNFRFAKY motifs found in the ectodomain of mammalian receptors. This suggests evolutionary divergence in structure-function relationships between Dictyostelium and vertebrate P2X receptors .

How can p2xD be used as a model system for studying ion channel evolution?

P2XD and other Dictyostelium P2X receptors offer valuable insights into ion channel evolution for several reasons:

  • Evolutionary distance: Dictyostelium diverged from the lineage leading to animals approximately 1 billion years ago. The presence of functional P2X receptors in this organism suggests that the P2X receptor family is ancient and predates the evolution of multicellularity in animals .

  • Conserved core function: Despite weak sequence similarity (approximately 15-20% identity), Dictyostelium p2xD maintains the core function of ATP-gated channel activity, suggesting strong evolutionary pressure to preserve this mechanism .

  • Adaptive specialization: The differences in localization (intracellular vs. plasma membrane) and ionic sensitivities between p2xD and vertebrate P2X receptors highlight adaptive evolution for specialized functions .

  • Minimal functional model: Dictyostelium P2X receptors may represent a more primitive version of these channels, providing insights into the essential structural elements required for ATP-gated channel function.

Comparative studies between p2xD and vertebrate P2X receptors can reveal which structural features are fundamental to channel function versus those that represent later adaptations for specialized signaling roles in complex multicellular organisms .

What are the comparative functional properties of all five Dictyostelium P2X receptors?

The five Dictyostelium P2X receptors exhibit distinct functional properties that suggest specialized roles:

PropertyP2XAP2XBP2XCP2XDP2XE
ATP-gated channel functionYesYesNoYesYes
Effect of acidic pH (6.2)Accelerated desensitizationIncreased currentN/ADecreased currentIncreased current
Sodium inhibitionWeakStrongN/AStrongStrong
Rescue of P2XA-null phenotypeCompletePartialNoneCompletePartial

These differences suggest a functional hierarchy among Dictyostelium P2X receptors, with P2XA and P2XD appearing to play primary roles in osmoregulation. The inability of P2XC to function as an ATP-gated channel or rescue the P2XA-null phenotype highlights the importance of channel activity for osmoregulatory function .

The varying abilities of different P2X receptors to rescue the P2XA-null phenotype indicate limited functional redundancy, suggesting each receptor may have specialized roles within the contractile vacuole system .

How might understanding p2xD function contribute to broader knowledge of purinergic signaling?

Research on p2xD contributes to our understanding of purinergic signaling in several significant ways:

  • Evolutionary origins: The presence of functional P2X receptors in Dictyostelium provides evidence for the ancient origins of purinergic signaling, suggesting that ATP-mediated signaling predates the evolution of specialized tissues and organs in multicellular organisms .

  • Intracellular purinergic signaling: The localization of p2xD to the contractile vacuole represents a novel functional role for P2X receptors on intracellular organelles, expanding our understanding of purinergic signaling beyond traditional cell-to-cell communication .

  • Pharmacological diversity: The distinct pharmacological profile of p2xD compared to vertebrate P2X receptors provides insights into the structural determinants of agonist recognition and channel modulation .

  • Physiological adaptations: The sensitivity of p2xD to ionic conditions and pH that differ from those affecting vertebrate P2X receptors highlights how purinergic signaling systems can adapt to diverse cellular environments and functions .

Understanding the function of p2xD in the relatively simple context of Dictyostelium osmoregulation may reveal fundamental principles of purinergic signaling that have been conserved throughout evolution but may be obscured by the complexity of mammalian systems .

What are common challenges in expressing functional recombinant p2xD and how can they be overcome?

Researchers frequently encounter several challenges when working with recombinant p2xD:

  • Poor expression of native sequence: Direct expression of the native Dictyostelium sequence in mammalian cells often results in poor protein expression or non-functional channels. Solution: Use codon-optimized ("humanized") versions of p2xD cDNA where each amino acid codon is replaced by that most commonly found in the host organism .

  • Protein misfolding: The evolutionary distance between Dictyostelium and expression host cells can lead to improper folding. Solution: Optimize expression conditions, including temperature (typically lowered to 30°C), and consider adding chemical chaperones to the culture medium.

  • Intracellular retention: Unlike in heterologous systems, p2xD naturally localizes to intracellular membranes in Dictyostelium. Solution: Addition of vertebrate P2X receptor trafficking motifs or fusion with fluorescent proteins can enhance surface expression in mammalian cells .

  • ATP degradation: ATP can be rapidly degraded by ectonucleotidases present in many experimental systems. Solution: Use non-hydrolyzable ATP analogs like ATP-γ-S for stable long-term recordings, or include ectonucleotidase inhibitors in recording solutions .

  • Variable functional responses: Responses may vary depending on ionic conditions. Solution: Systematically test different ionic compositions, particularly comparing sodium- versus potassium-based solutions, and carefully control pH .

How should experimental conditions be optimized for studying p2xD in different research contexts?

Optimization of experimental conditions is critical for successful research on p2xD:

For heterologous expression studies:

  • Use HEK293 cells with humanized p2xD cDNA constructs

  • Transfect with lower plasmid concentrations (0.1-1 μg) for electrophysiology

  • Include a fluorescent marker (e.g., GFP) for identifying transfected cells

  • Allow 24-48 hours for expression before experiments

  • Consider reduced temperature incubation (30°C) to improve folding

For electrophysiological recordings:

  • Test multiple ionic conditions, particularly comparing Na⁺ vs. K⁺ as the main cation

  • Examine responses at different pH values (7.4, 6.2)

  • Use ATP concentrations between 10-300 μM

  • For single-channel recordings, use outside-out patch configuration

  • For pharmacological studies, consider the inhibitory effect of Cu²⁺ at nanomolar concentrations

For Dictyostelium studies:

  • Transform cells by electroporation and select with G418

  • Use GFP-tagged constructs to verify contractile vacuole localization

  • Perform osmoregulation assays in hypotonic conditions, monitoring cell volume for 40-60 minutes

  • Co-stain with calmodulin to confirm contractile vacuole localization

These optimized conditions will maximize the reliability and reproducibility of experiments investigating p2xD structure and function.

What are promising approaches for determining the high-resolution structure of p2xD?

Several approaches hold promise for determining the high-resolution structure of p2xD:

  • Cryo-electron microscopy (cryo-EM): This technique has revolutionized membrane protein structural biology and would be particularly suitable for p2xD, especially if combined with engineered constructs that enhance stability and expression levels.

  • X-ray crystallography: Although challenging for membrane proteins, this approach could work with p2xD if suitable crystallization conditions are identified. The use of antibody fragments or nanobodies to stabilize the receptor in specific conformations might facilitate crystallization.

  • Hybrid approaches: Combining lower-resolution structural techniques (such as small-angle X-ray scattering or negative-stain EM) with computational modeling and experimental constraints from mutagenesis and functional studies.

  • Expression optimization: Development of specialized expression systems that yield larger quantities of properly folded p2xD, possibly including insect cell expression or cell-free systems.

  • Protein engineering: Creation of chimeric constructs incorporating domains from vertebrate P2X receptors with known structures to facilitate structural determination while maintaining key features of p2xD.

Structural information would be invaluable for understanding the unique properties of p2xD, including its distinct ATP binding site and sensitivity to ionic conditions and pH .

How might p2xD be utilized as a tool for studying contractile vacuole function?

P2XD offers several promising applications as a tool for studying contractile vacuole function:

  • Fluorescent biosensors: Development of p2xD-based sensors that change fluorescence properties upon ATP binding or channel activation could provide real-time readouts of contractile vacuole ATP levels or activity.

  • Optogenetic control: Engineering light-sensitive variants of p2xD could enable precise temporal control of contractile vacuole function, allowing researchers to manipulate osmoregulation with unprecedented precision.

  • Contractile vacuole proteomics: Using p2xD as a bait protein in proximity labeling approaches could identify novel protein-protein interactions within the contractile vacuole system.

  • Comparative studies: Expressing p2xD in other protists with contractile vacuoles could provide insights into the evolutionary conservation of osmoregulatory mechanisms.

  • Drug discovery platform: The distinct pharmacological profile of p2xD compared to vertebrate P2X receptors makes it a potential target for the development of specific modulators, which could serve as tools for dissecting contractile vacuole function .

The unique intracellular localization and function of p2xD make it an attractive candidate for developing specialized tools to study this essential osmoregulatory organelle in protists.

What potential applications exist for p2xD in synthetic biology and biotechnology?

P2XD offers several innovative applications in synthetic biology and biotechnology:

  • Engineered osmoregulatory systems: Integration of p2xD into synthetic cells or vesicles could provide controlled osmoregulation capabilities, potentially useful for drug delivery systems or artificial cells.

  • Biosensors for intracellular ATP: The ATP sensitivity of p2xD could be harnessed to develop sensors for monitoring ATP levels in acidic intracellular compartments where other sensors may not function optimally.

  • Novel drug screening platforms: The distinct pharmacology of p2xD compared to vertebrate P2X receptors makes it a potential target for identifying novel compounds that modulate specific P2X receptor subtypes, as demonstrated in Drosophila taste neuron systems used for screening P2X agonists .

  • Synthetic organelles: Engineering p2xD-containing membrane systems could contribute to the development of synthetic organelles with controlled ion flux properties.

  • Evolutionary models: As a representative of an ancient ion channel family, p2xD could serve as a starting point for directed evolution experiments aimed at understanding the evolutionary pathways that led to the diverse P2X receptor family in vertebrates.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.