Recombinant Dictyostelium discoideum P2X receptor E (p2xE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us; we will prioritize its implementation.
Synonyms
p2xE; DDB_G0288061; P2X receptor E; P2XE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-388
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
p2xE
Target Protein Sequence
MNFRNIDWDSLFSYSTIKIVRIRDKRLGILHFAFLIGIILYIIVGTIFLQKKYLVLESPI GSIRTSLMAPSVKPTDLPYCLKNGTDTSYDGYPNKPCQYWDEYLVLYPPSEESSMFITTR CTQETQSTVNGCNLSEPTCVYNTTSSSDFYIANVENFTILLDHTLSAPSLGIQYNGAQLN GQLLDTDGNPMSLPPPNIVGVKGSPDIMSLQGVLTAAGVESLDSQGLANKSRTIRDDGIL ILCFITYSNTYTYNTGNYHYTYQFKLVQNTKYKIVEPVFTKDVEDRYIFDRHGVRIIFIQ TGQLGQFDFQTMLLTFVSGIGLVTAASLIVDIIATRIMPQRSRYQELKFQDSSINNTQKT PTNDHTPLLKDNEDTINENSYQNNSYEK
Uniprot No.

Target Background

Function

Recombinant Dictyostelium discoideum P2X receptor E (p2xE) Background

P2X receptors are ATP-gated ion channels crucial for intracellular calcium signaling. They are not required for purinergic responses to extracellular nucleotides, nor are they essential for osmoregulation. p2xE exhibits inward currents elicited by intracellular ATP. The ATP analog, β,γ-imido-ATP, acts as a weak partial agonist. p2xE shows exclusive selectivity for ATP over other nucleotides, and is insensitive to copper and the P2 receptor antagonists PPADS and suramin, while being strongly inhibited by sodium ions. It demonstrates greater permeability to ammonium than sodium or potassium ions, and lower permeability to choline. Calcium ions are permeable, but chloride ions are not.

Database Links
Protein Families
P2X receptor family
Subcellular Location
Contractile vacuole membrane. Note=Ligand binding domain within the lumen of the vacuole.

Q&A

What is Dictyostelium discoideum P2X Receptor E (p2xE) and How Does It Function in Cellular Systems?

Dictyostelium discoideum P2X receptor E (p2xE) is one of five P2X-like proteins (P2XA-E) found in the soil-living amoeba Dictyostelium discoideum that functions as an ATP-activated ion channel . Unlike mammalian P2X receptors which are predominantly found on the plasma membrane, p2xE is intracellularly localized to the contractile vacuole with the ligand binding domain facing the lumen . The receptor forms functional ATP-activated ion channels but requires specific ionic conditions for optimal activity, with potassium being the predominant cation on both sides of the membrane at pH 6.2 .

Functionally, p2xE was initially thought to be involved in osmoregulation (cell volume regulation in hypotonic environments), but more recent studies with quintuple knockout strains have revealed that its primary role may be related to intracellular calcium signaling rather than essential osmoregulation . When expressed in P2XA-deficient cells, p2xE can rescue the osmoregulatory phenotype but requires higher expression levels compared to P2XA and P2XD to achieve this effect .

How Do the Functional Properties of p2xE Compare to Other Dictyostelium P2X Receptors?

The functional properties of p2xE differ significantly from other P2X receptors in Dictyostelium, particularly in terms of sensitivity to ATP, response to agonists, and ability to rescue osmoregulatory phenotypes.

Table 1: Comparative Functional Properties of Dictyostelium P2X Receptors

PropertyP2XAP2XBP2XCP2XDP2XE
ATP Sensitivity (EC₅₀)97 μM266 μMNon-functionalFunctional under low Na⁺511 μM
β,γ-imido-ATP efficacyFull agonist (EC₅₀ 15 μM)Full agonist (EC₅₀ 85 μM)Non-functionalNot determinedWeak partial agonist (22% at 3 mM)
α,β-methylene ATPFull agonist (EC₅₀ 95 μM)Not determinedNon-functionalNot determinedNot effective
Cu²⁺ inhibitionIC₅₀ 40 nM85% at 100 nMNot determined30% at 100 nM70% at 100 nM
Osmoregulatory rescue efficiencyHigh (even at low expression)Incomplete (even at high expression)No rescueHigh (at low expression)Moderate (requires high expression)
DesensitizationSlow (>20s)Slow (>20s)N/ASlow (>20s)Slow (>20s)

P2XE forms functional ATP-activated ion channels but differs from other Dictyostelium P2X receptors in having lower sensitivity to ATP and less efficacy in rescuing the osmoregulatory phenotype in P2XA-deficient cells . While P2XA, P2XB, P2XD, and P2XE exhibit robust currents in response to ATP application, P2XC receptors showed no response under any tested conditions . All functional Dictyostelium P2X receptors are insensitive to common P2X antagonists like suramin and PPADS but are inhibited by copper ions to varying degrees .

What Are the Optimal Experimental Conditions for Studying Recombinant p2xE Function?

For optimal functional studies of recombinant p2xE, several experimental conditions must be carefully controlled:

Expression Systems and Construct Design:

Both HEK293 cells and Xenopus laevis oocytes have been successfully used to express functional p2xE . For Dictyostelium expression, the coding sequences can be amplified by PCR and cloned as translational fusions into appropriate plasmids (e.g., pdm324) with fluorescent tags (RFP/GFP) at BglII and SpeI sites . Humanized versions of the p2xE receptor cDNAs can be synthesized for mammalian expression systems, typically tagged at the C terminus with sequences like EYMPME (EE tag) and subcloned into vectors such as pcDNA3.1 .

Optimal Recording Conditions:

  • Ionic Composition: p2xE shows robust currents when potassium is the predominant cation on both sides of the membrane with pH 6.2 .

  • Agonists: ATP is the primary agonist (EC₅₀ 511 μM); β,γ-imido-ATP acts as a weak partial agonist .

  • Inhibitors: Currents in p2xE are strongly inhibited by Na⁺ and can be inhibited by Cu²⁺ (70% inhibition at 100 nM) .

  • pH Sensitivity: Activity is modified by extracellular pH, with more acidic conditions generally favorable .

Phenotypic Assays:

For osmoregulatory studies, transfer cells from buffered solutions to water and monitor morphological changes over 30-60 minutes using microscopy . Calculate the circularity index (ratio of two perpendicular cell diameters) to quantify regulatory volume decrease efficiency . In wild-type cells, this value changes from approximately 0.84 (swollen) to 0.65 (normal) .

Functional Characterization:

  • Electrophysiology: Whole-cell patch-clamp recordings in heterologous expression systems to measure ATP-evoked currents .

  • Calcium Imaging: Using apoaequorin-expressing strains or calcium-sensitive dyes to monitor calcium flux in response to receptor activation .

  • Biochemical Assays: Western blotting and biotinylation to measure total protein and membrane expression .

  • Fluorescence Microscopy: RFP/GFP-tagged constructs to visualize subcellular localization .

Protein Quality Assessment:

SDS-PAGE analysis should confirm >90% purity, with protein identity verified by mass spectrometry . Functional activity can be assessed through ATP binding assays or electrophysiological measurements of channel activity in reconstituted systems.

How Can Researchers Address the Apparent Contradictions in Literature Regarding p2xE Function?

Several contradictions exist in the literature regarding p2xE function that researchers should be aware of when designing experiments:

Osmoregulatory Role Controversy:

  • Refined Genetic Models: Create conditional or tissue-specific knockout/knockdown of p2xE

  • Quantitative Assays: Develop more sensitive measures of osmoregulatory efficiency

  • Compensatory Mechanism Analysis: Investigate potential alternative pathways that may be upregulated in knockout cells

Electrophysiological Property Discrepancies:

Some studies report that ATP evokes inward currents at p2xE receptors, while the optimal conditions and response magnitudes vary between reports . These differences can be reconciled through:

  • Standardized Recording Conditions: Establish consistent ionic compositions, pH, and temperature

  • Multiple Expression Systems: Compare results between different heterologous systems (HEK cells, Xenopus oocytes)

  • Native vs. Recombinant Comparison: Study the properties in both native Dictyostelium and heterologous systems

Physiological Ligand Uncertainty:

While ATP activates p2xE in vitro, the physiological ligand in the contractile vacuole lumen remains uncertain, especially given the high EC₅₀ for ATP (511 μM) . Researchers can address this through:

  • In Vivo ATP Measurements: Develop methods to measure ATP concentrations in the contractile vacuole lumen

  • Alternative Ligand Screening: Test other nucleotides and potential physiological molecules

  • Structure-Function Analysis: Identify key binding residues through mutagenesis to understand ligand specificity

Structural Features:

The p2xE receptor consists of 388 amino acids, making it similar in size to mammalian P2X4 (388 aa) but significantly shorter than P2X7 (595 aa) . While no crystal structure exists specifically for p2xE, structural predictions can be made based on homology modeling with mammalian P2X receptors. The protein likely forms trimeric assemblies with each subunit containing two transmembrane domains, a large extracellular domain housing the ATP binding site, and relatively short intracellular domains .

Key Structural Differences from Mammalian P2X Receptors:

  • Transmembrane Domain Organization: Sequence analysis suggests differences in the arrangement and properties of the transmembrane domains that may explain the unusual ion permeability characteristics of p2xE .

  • ATP Binding Pocket: The lower sensitivity to ATP (EC₅₀ 511 μM compared to 0.5-10 μM for mammalian receptors) suggests structural differences in the ATP binding pocket .

  • C-terminal Region: The C-terminal tail of p2xE (29 amino acids) is significantly shorter than those of P2X2 (113 aa) and P2X7 (240 aa), which may explain differences in trafficking and protein-protein interactions .

Methodological Approaches for Structural Studies:

  • Homology Modeling: Using mammalian P2X crystal structures as templates to predict p2xE structure

  • Site-Directed Mutagenesis: Identifying key functional residues involved in ATP binding, channel gating, and ion selectivity

  • Cryo-EM Analysis: Pursuing high-resolution structural determination of purified recombinant p2xE

  • Chimeric Receptor Construction: Creating fusion proteins between p2xE and mammalian P2X receptors to identify domain-specific functions

How Does p2xE Contribute to Intracellular Calcium Signaling in Dictyostelium?

The role of p2xE in intracellular calcium signaling in Dictyostelium involves several interconnected mechanisms:

Evidence for Calcium Signaling Involvement:

In quintuple p2xA/B/C/D/E null cells, responses to the calmodulin antagonist calmidazolium are reduced compared to wild-type cells, suggesting that P2X receptors, including p2xE, play a role in intracellular calcium signaling pathways involving calmodulin . This indicates that while P2X receptors may not be essential for osmoregulation, they contribute significantly to calcium-dependent signaling processes.

Proposed Signaling Mechanisms:

  • Contractile Vacuole as Calcium Store: The contractile vacuole, where p2xE is localized, may function as an intracellular calcium store. ATP binding to p2xE could trigger calcium release from this compartment into the cytosol .

  • Calcium-Induced Calcium Release: Initial calcium influx through p2xE channels might trigger further calcium release from other intracellular stores through calcium-sensitive channels.

  • Integration with Other Signaling Pathways: P2X-mediated calcium signals likely interact with other signaling networks, particularly during transitions between unicellular and multicellular stages of the Dictyostelium life cycle .

Experimental Approaches:

  • Real-time Calcium Imaging: Using calcium-sensitive fluorescent dyes (Fura-2) or genetically encoded calcium indicators (GCaMP) to visualize calcium dynamics in wild-type versus p2xE-null cells .

  • Pharmacological Manipulation: Applying ATP, calmodulin antagonists, and other signaling modulators to dissect pathway components .

  • Combined Calcium Imaging and Electrophysiology: Correlating channel activity with calcium signals to establish causal relationships.

  • Subcellular Calcium Measurements: Targeting calcium indicators to specific compartments to distinguish between global and localized calcium signals.

What Role Does p2xE Play in the Evolutionary Biology of Purinergic Signaling?

Dictyostelium P2X receptors, including p2xE, provide valuable insights into the evolutionary history of purinergic signaling:

Evolutionary Significance:

The intracellular localization of Dictyostelium P2X receptors contrasts with the cell surface expression in vertebrates, suggesting either that:

  • P2X receptors originated as intracellular channels that later relocated to the plasma membrane in the vertebrate lineage

  • The intracellular localization in Dictyostelium represents a derived state that evolved from ancestral cell surface receptors

Methodological Approaches for Evolutionary Studies:

  • Phylogenetic Analysis: Sequence comparison of p2xE with P2X receptors from diverse organisms to construct evolutionary trees .

  • Functional Comparative Studies: Expressing p2xE in mammalian cells and mammalian P2X receptors in Dictyostelium to compare functional properties across species .

  • Chimeric Receptor Construction: Combining domains from p2xE and mammalian P2X receptors to identify evolutionarily conserved functional modules.

  • Comparative Genomics: Analyzing genomic organization of P2X genes across species to identify conservation patterns and evolutionary events.

  • Ancestral Sequence Reconstruction: Using computational methods to infer the properties of ancestral P2X receptors that gave rise to both Dictyostelium and vertebrate P2X families.

Imaging and Microscopy Approaches:

  • Time-lapse Confocal Microscopy: Visualizing GFP/RFP-tagged p2xE in live Dictyostelium cells during osmotic challenges to track contractile vacuole dynamics .

  • Super-resolution Microscopy: Using techniques like STORM or PALM to precisely localize p2xE within the contractile vacuole membrane at nanometer resolution.

  • Correlative Light and Electron Microscopy (CLEM): Combining fluorescence microscopy with electron microscopy to correlate p2xE localization with ultrastructural features of the contractile vacuole.

Functional Analysis Methods:

  • Contractile Vacuole Fusion Assays: Measuring the frequency and extent of contractile vacuole fusion with the plasma membrane in wild-type versus p2xE-mutant cells .

  • Volumetric Analysis: Quantifying contractile vacuole size changes during filling and discharge cycles using 3D reconstruction from confocal z-stacks.

  • Photo-manipulation Techniques: Using caged ATP or optogenetic tools to activate p2xE in specific regions of the contractile vacuole.

Biochemical and Molecular Approaches:

  • Vacuole Isolation: Purifying contractile vacuoles to measure ATP concentrations and protein composition.

  • Proximity Labeling: Using BioID or APEX2 fused to p2xE to identify neighboring proteins in the contractile vacuole.

  • CRISPR-Cas9 Gene Editing: Creating precise mutations in the endogenous p2xE gene to study structure-function relationships.

Quantification Metrics:

  • Circularity Index: Measuring the ratio of two perpendicular cell diameters to quantify cell morphology during osmotic challenge .

  • Contractile Vacuole Cycle Parameters: Timing the complete cycle of filling and discharge, measuring maximum vacuole diameter, and quantifying discharge efficiency.

  • Regulatory Volume Decrease (RVD) Kinetics: Tracking the rate and extent of volume recovery following hypotonic shock in cells with different levels of p2xE expression .

Expression and Purification Challenges:

  • Low Expression Yields: Optimize codon usage for the expression system, try different affinity tags (His, GST, MBP), and test various induction conditions (temperature, inducer concentration, duration) .

  • Protein Stability: Add stabilizing agents such as trehalose (6%) to storage buffers and avoid repeated freeze-thaw cycles .

  • Protein Aggregation: Use gentle detergents for membrane protein solubilization and consider adding glycerol (5-50%) to maintain protein solubility .

Functional Assay Optimization:

  • Heterologous Expression Variability: Standardize transfection protocols, use inducible expression systems, and verify surface expression through biotinylation or immunofluorescence .

  • Electrophysiological Recording Challenges: Optimize pipette and bath solutions to match the unique ion requirements of p2xE (potassium-rich, low sodium, pH 6.2) .

  • Signal-to-Noise Ratio: Enhance agonist responses by removing external sodium and adjusting pH conditions to maximize channel activity .

Data Analysis and Interpretation:

  • Contradictory Results: Carefully document all experimental conditions, perform positive and negative controls, and directly compare results with published protocols.

  • Expression Level Effects: Quantify p2xE expression levels (via fluorescence intensity of tagged constructs) and correlate with functional outcomes .

  • Statistical Robustness: Ensure adequate biological replicates (n≥6 for each condition) and apply appropriate statistical tests for data validation .

This comprehensive FAQ guide provides both basic and advanced insights into Dictyostelium discoideum P2X receptor E (p2xE) research, offering methodological approaches to address key questions in this field while highlighting current knowledge and unresolved issues that present opportunities for future investigation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.