Recombinant Dictyostelium discoideum PA-phosphatase related-family protein DDB_G0268928 (DDB_G0268928)

What is the molecular structure of Recombinant Dictyostelium discoideum PA-phosphatase related-family protein DDB_G0268928?

Recombinant Dictyostelium discoideum PA-phosphatase related-family protein DDB_G0268928 (Q55F11) is a full-length protein consisting of 551 amino acids. The protein sequence begins with MGVQQQSELPSQTSAKYFSLREDVSTESLSDIDSQTDINNTGNSGKDYSSPPRLSLWGWY and continues through to the C-terminal sequence ending with FQNILSKFNNK . The protein contains multiple hydrophobic regions, particularly in the middle portion of the sequence, suggesting transmembrane domains or membrane-association capabilities. The protein can be produced with an N-terminal His-tag for purification and detection purposes .

The amino acid composition suggests a protein with potentially multiple functional domains, though specific structural motifs must be identified through computational prediction and experimental validation techniques such as X-ray crystallography or cryo-electron microscopy.

How is recombinant DDB_G0268928 protein typically expressed and purified for research applications?

The recombinant DDB_G0268928 protein is typically expressed in E. coli expression systems with an N-terminal His-tag fusion to facilitate purification . The expression process involves:

• Transforming E. coli with a plasmid construct containing the DDB_G0268928 gene sequence fused to a His-tag coding sequence

• Inducing protein expression under optimized conditions

• Harvesting cells and lysing to release the recombinant protein

• Purifying using affinity chromatography, typically with Ni-NTA or similar matrices that bind the His-tag

• Additional purification steps as needed (ion exchange, size exclusion)

The purified protein is typically supplied as a lyophilized powder with purity greater than 90% as determined by SDS-PAGE . For research applications, the protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, and glycerol (final concentration 5-50%) should be added before aliquoting for long-term storage at -20°C/-80°C .

What is the predicted function of DDB_G0268928 based on sequence homology and domain analysis?

The DDB_G0268928 protein is classified as a PA-phosphatase related-family protein , suggesting potential involvement in phospholipid metabolism or signaling pathways. While the search results don't provide explicit functional information for DDB_G0268928 specifically, we can infer possible functions based on:

• The PA-phosphatase designation suggests potential involvement in dephosphorylating phosphatidic acid (PA), which is a critical lipid involved in membrane dynamics and signaling

• Dictyostelium discoideum uses phospholipid signaling extensively during chemotaxis and development

• Other phospholipid-interacting proteins in Dictyostelium, such as those that interact with phosphatidylinositol (3,4,5)-triphosphate (PtdInsP3), play crucial roles in directional sensing and pseudopod extension during cell migration

Function prediction requires further experimental validation through techniques such as gene knockout studies, localization studies, and biochemical assays of enzymatic activity.

How should I design experiments to investigate the potential role of DDB_G0268928 in Dictyostelium chemotaxis?

Designing experiments to investigate DDB_G0268928's role in chemotaxis requires a systematic approach:

• Define your variables clearly:

  • Independent variable: DDB_G0268928 expression/activity levels

  • Dependent variable: Chemotactic efficiency/accuracy

  • Control variables: Cell density, chemoattractant concentration, buffer composition

• Generate specific hypotheses:

  • Example: "DDB_G0268928 is required for efficient chemotaxis toward cAMP in Dictyostelium discoideum"

• Design experimental treatments:

  • Generate DDB_G0268928 knockout strains using CRISPR-Cas9 or homologous recombination

  • Create overexpression strains with the protein under an inducible promoter

  • Develop point mutants affecting predicted functional domains

• Implement appropriate assays:

  • Under-agarose chemotaxis assays toward cAMP gradients

  • Micropipette assays for single-cell directional response

  • Population-based Dunn chamber or Boyden chamber assays

• Analysis methods:

  • Track cell movement parameters (speed, directedness, persistence)

  • Measure PtdInsP3 localization using PH-domain reporters

  • Analyze cytoskeletal dynamics during migration

This experimental design approach parallels methods used to study other PH domain-containing proteins in Dictyostelium, such as PhdB and PhdG, which have been demonstrated to be required for efficient chemotaxis .

What controls should be implemented when studying the membrane localization patterns of DDB_G0268928?

When investigating membrane localization patterns of DDB_G0268928, implement the following controls to ensure experimental validity:

• Positive controls:

  • Known membrane-localized proteins in Dictyostelium (e.g., PhdI which localizes to the plasma membrane in a PtdInsP3-dependent manner )

  • Membrane-specific dyes to confirm membrane integrity

• Negative controls:

  • Cytosolic fluorescent protein expression (e.g., GFP alone)

  • Cells treated with PI3K inhibitors if PtdInsP3-dependent localization is hypothesized

• Domain-specific controls:

  • Truncated constructs lacking specific domains to determine domain requirements for localization

  • Point mutations in potential lipid-binding motifs

  • Similar to experiments with PhdB, which binds plasma membrane through both PtdInsP3-dependent and independent mechanisms

• Cell state controls:

  • Starved vs. vegetative cells

  • Cells at different developmental stages

  • Cells in uniform chemoattractant vs. gradient conditions

• Genetic background controls:

  • Wild-type cells

  • PI3K mutants with altered PtdInsP3 production

  • PTEN mutants with elevated PtdInsP3 levels (similar to experiments showing PhdG membrane localization in pten- cells )

Using this comprehensive control strategy will help determine whether DDB_G0268928 localization is constitutive or regulated by specific signals, similar to the differential localization patterns observed with PhdB, PhdG, and PhdI in Dictyostelium .

How do I optimize protein expression conditions for maximum yield of functional DDB_G0268928?

Optimizing expression conditions for maximum yield of functional DDB_G0268928 requires systematic testing of multiple parameters:

• Expression system selection:

  • E. coli is the documented system for DDB_G0268928 expression

  • Consider BL21(DE3), Rosetta, or Origami strains for improved expression

  • For complex proteins, insect or mammalian expression systems may preserve functionality

• Optimization matrix:

  Parameter	Variables to Test	Notes
  Temperature	16°C, 25°C, 30°C, 37°C	Lower temperatures may improve folding
  Induction OD600	0.4, 0.6, 0.8, 1.0	Optimal cell density for induction
  Inducer concentration	0.1-1.0 mM IPTG	Titrate for optimal expression
  Media composition	LB, TB, 2xYT, auto-induction	Rich media may improve yield
  Induction time	3h, 6h, overnight	Balance expression time with aggregation risk

• Solubility enhancement strategies:

  • Co-express with chaperones (GroEL/GroES, DnaK/DnaJ)

  • Add solubility enhancers like sorbitol or betaine to media

  • Use fusion partners (MBP, SUMO, thioredoxin) if His-tag alone is insufficient

• Purification optimization:

  • Test different lysis buffers with varying salt concentrations

  • Include stabilizing agents (glycerol, reducing agents)

  • Optimize imidazole concentrations for binding and elution

  • Consider on-column refolding for inclusion body recovery

• Quality assessment:

  • SDS-PAGE for purity (target >90%)

  • Size exclusion chromatography for aggregation analysis

  • Activity assays to confirm functionality

  • Circular dichroism to verify proper folding

Following reconstitution from lyophilized powder, the protein should be stored in aliquots with 5-50% glycerol at -20°C/-80°C to maintain stability and avoid repeated freeze-thaw cycles .

What approaches can be used to identify potential binding partners of DDB_G0268928 in Dictyostelium cells?

Identifying binding partners of DDB_G0268928 requires multiple complementary approaches:

• Affinity purification coupled to mass spectrometry (AP-MS):

  • Express His-tagged DDB_G0268928 in Dictyostelium cells

  • Perform crosslinking to capture transient interactions

  • Purify using Ni-NTA beads under native conditions

  • Identify co-purifying proteins by mass spectrometry

  • Similar to the proteomics approach used to identify PtdInsP3-binding proteins in Dictyostelium

• Proximity-based labeling:

  • Create BioID or TurboID fusions with DDB_G0268928

  • Express in Dictyostelium cells and provide biotin

  • Purify biotinylated proteins and identify by mass spectrometry

  • Compare results between resting cells and stimulated cells

• Yeast two-hybrid screening:

  • Use DDB_G0268928 as bait against a Dictyostelium cDNA library

  • Validate positive interactions using co-immunoprecipitation

  • Map interaction domains using truncated constructs

• In vitro binding assays:

  • Perform lipid binding assays similar to those used for PhdB, PhdG, and PhdI

  • Test for PtdInsP3 binding using liposome sedimentation assays

  • Conduct phospholipid overlay assays to determine lipid specificity

• Bioinformatic prediction and validation:

  • Predict interactions based on domain analysis

  • Look for proteins with complementary domains

  • Validate top candidates with co-localization studies

The combination of these approaches will provide robust evidence for protein-protein and protein-lipid interactions of DDB_G0268928, similar to how multiple PH domain-containing proteins were characterized in Dictyostelium .

How might post-translational modifications affect DDB_G0268928 function, and how can these be experimentally determined?

Post-translational modifications (PTMs) can significantly alter DDB_G0268928 function through multiple mechanisms. Here's a comprehensive approach to study them:

• Computational prediction of potential PTM sites:

  • Phosphorylation sites (especially in PA-phosphatase domains)

  • Glycosylation sites

  • Ubiquitination/SUMOylation sites

  • Lipid modification sites (prenylation, myristoylation)

• Mass spectrometry-based identification:

  • Purify DDB_G0268928 from Dictyostelium cells

  • Digest with multiple proteases for optimal coverage

  • Analyze by LC-MS/MS with PTM-specific settings

  • Compare PTM profiles between different cellular conditions

  PTM Type	MS Strategy	Expected Mass Shift
  Phosphorylation	TiO2 enrichment	+80 Da
  Ubiquitination	K-ε-GG antibody	+114 Da (remnant)
  Acetylation	Direct analysis	+42 Da
  Glycosylation	Lectin enrichment	Variable

• Functional validation experiments:

  • Site-directed mutagenesis of identified PTM sites

  • Phosphomimetic mutations (S/T→D/E) and phosphonull mutations (S/T→A)

  • Express mutants in DDB_G0268928-knockout backgrounds

  • Assess impact on localization, activity, and protein interactions

• Regulatory enzyme identification:

  • Use inhibitors of kinases, phosphatases, or other PTM enzymes

  • Perform siRNA screens of candidate modifying enzymes

  • Co-immunoprecipitation with candidate modifying enzymes

• Dynamics studies:

  • Analyze PTM changes during development

  • Monitor modifications during chemotactic stimulation

  • Compare PTM patterns in different nutritional states

These approaches will provide insights into how PTMs regulate DDB_G0268928, similar to how phosphorylation regulates many signaling components in Dictyostelium chemotaxis pathways .

What role might DDB_G0268928 play in phospholipid signaling networks during Dictyostelium development and chemotaxis?

DDB_G0268928, as a PA-phosphatase related-family protein, likely plays a significant role in phospholipid signaling during Dictyostelium development and chemotaxis. A comprehensive investigation would include:

• Developmental expression analysis:

  • Examine DDB_G0268928 expression throughout the Dictyostelium life cycle

  • Compare expression patterns with known developmental regulators

  • Assess if expression is regulated by key developmental transcription factors

• Subcellular localization studies:

  • Create fluorescent protein fusions to visualize dynamics

  • Determine if localization changes during chemotaxis, similar to PhdI which localizes to the leading edge of migrating cells

  • Assess co-localization with PtdInsP3 markers during directed migration

• Lipid interaction profiling:

  • Test binding to various phospholipids including phosphatidic acid (PA) and phosphoinositides

  • Determine if binding is regulated by development or chemotactic stimulation

  • Compare with other PH domain-containing proteins that interact with PtdInsP3

• Genetic interaction studies:

  • Generate double mutants with genes in related pathways (pi3k, pten, pla2)

  • Perform epistasis analysis to place DDB_G0268928 in signaling networks

  • Test rescue of phenotypes with related proteins

• Functional impact analysis:

  • Assess chemotaxis efficiency in DDB_G0268928 mutants

  • Measure phospholipid dynamics using fluorescent reporters

  • Quantify developmental progression and timing

Based on studies of similar proteins, DDB_G0268928 may function analogously to other PH domain-containing proteins in Dictyostelium, which are required for efficient chemotaxis and may bind to the plasma membrane through both phospholipid-dependent and independent mechanisms .

What are the optimal storage and handling conditions for maintaining DDB_G0268928 stability and activity?

Maintaining DDB_G0268928 stability and activity requires careful attention to storage and handling conditions:

• Short-term storage recommendations:

  • Store working aliquots at 4°C for no more than one week

  • Avoid repeated freeze-thaw cycles as they can cause protein denaturation

  • Keep in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

• Long-term storage protocol:

  • Store at -20°C/-80°C upon receipt

  • Aliquot into single-use volumes to prevent freeze-thaw damage

  • Add glycerol to a final concentration of 5-50% (recommended 50%)

  • Ensure airtight sealing to prevent sublimation during freezer storage

• Reconstitution procedure:

  • Briefly centrifuge vials before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Allow complete dissolution before use

  • Filter-sterilize if needed for cell-based applications

• Activity preservation strategies:

  • Include protease inhibitors when working with cell lysates

  • Add reducing agents (DTT, β-mercaptoethanol) if disulfide formation is a concern

  • Consider stabilizing additives (trehalose, glycerol, BSA) for dilute solutions

  • Maintain consistent pH and ionic strength

• Quality control measures:

  • Periodically verify protein integrity by SDS-PAGE

  • Assess activity using functional assays

  • Monitor aggregation state by dynamic light scattering or size exclusion chromatography

Following these guidelines will maximize protein stability and preserve activity for experimental applications, consistent with the manufacturer's recommendations for this recombinant protein .

How can I design knockout and knockdown experiments to study DDB_G0268928 function in Dictyostelium?

Designing effective knockout and knockdown experiments for DDB_G0268928 requires careful consideration of methodological approaches:

• CRISPR-Cas9 knockout strategy:

  • Design sgRNAs targeting early exons of DDB_G0268928

  • Include homology arms for targeted insertion of selection markers

  • Screen transformants by PCR and confirm by sequencing

  • Verify protein loss by Western blot

  • Create rescue strains expressing wild-type protein to confirm specificity

• Homologous recombination approach:

  • Design targeting construct with selection cassette flanked by homology arms

  • Transform Dictyostelium cells using electroporation

  • Select transformants with appropriate antibiotics

  • Confirm integration by PCR and Southern blot

  • Similar to the approach used for deleting genes encoding PhdB and PhdG

• Inducible knockdown systems:

  • Design antisense or RNAi constructs under tetracycline-inducible promoters

  • Create stable cell lines and confirm inducibility

  • Quantify protein reduction by Western blot

  • Titrate inducer to achieve different levels of knockdown

• Phenotypic analysis matrix:

  Phenotype	Assay	Control Comparison
  Growth	Growth curves	Wild-type cells
  Development	Development on filters	Rescue strains
  Chemotaxis	Under-agarose assay	PhdB/PhdG knockouts
  Endocytosis	FITC-dextran uptake	PI3K inhibitor treatment
  Cell adhesion	Substrate attachment	Related protein mutants

• Molecular phenotype assessment:

  • Analyze phospholipid dynamics using biosensors

  • Measure PA levels using biochemical assays

  • Assess cytoskeletal organization during migration

  • Quantify PtdInsP3-dependent processes

This comprehensive approach to knockout/knockdown design parallels established methods for studying other Dictyostelium proteins like PhdB and PhdG, which were successfully deleted to demonstrate their roles in chemotaxis .

What techniques should be employed to study the potential enzymatic activity of DDB_G0268928 as a PA-phosphatase related protein?

Investigating the potential enzymatic activity of DDB_G0268928 as a PA-phosphatase related protein requires multiple complementary biochemical approaches:

• In vitro phosphatase activity assays:

  • Prepare purified recombinant DDB_G0268928 protein

  • Test activity using:
    a) Artificial substrates (p-nitrophenyl phosphate)
    b) Radiolabeled phosphatidic acid
    c) Fluorescent phosphatase substrates

  • Measure product formation by spectrophotometry, scintillation counting, or fluorescence

• Substrate specificity determination:

  • Test activity against multiple phospholipids:
    a) Phosphatidic acid (PA)
    b) Lysophosphatidic acid (LPA)
    c) Diacylglycerol pyrophosphate (DGPP)
    d) Various phosphoinositides

  • Analyze products by thin-layer chromatography or mass spectrometry

  Substrate	Detection Method	Expected Product
  PA	TLC/MS	Diacylglycerol
  LPA	TLC/MS	Monoacylglycerol
  DGPP	TLC/MS	PA
  PtdInsP3	TLC/MS	PtdInsP2

• Kinetic parameter determination:

  • Measure initial rates at varying substrate concentrations

  • Calculate Km, Vmax, and kcat values

  • Determine optimal pH, temperature, and ion requirements

  • Assess effects of potential inhibitors

• Structure-function relationships:

  • Generate point mutations in predicted catalytic residues

  • Create truncated constructs to identify essential domains

  • Perform activity assays with mutant proteins

  • Correlate enzyme activity with binding capacity

• Cell-based activity assessment:

  • Overexpress wild-type or catalytically inactive mutants

  • Measure cellular PA levels using lipidomics approaches

  • Monitor downstream effects on PA-dependent processes

  • Compare with known PA phosphatases

These methodological approaches will definitively establish whether DDB_G0268928 possesses PA-phosphatase activity, determine its substrate specificity, and characterize its enzymatic properties, similar to how the functions of other phospholipid-interacting proteins have been characterized in Dictyostelium .

How can we integrate data on DDB_G0268928 function into broader models of phospholipid signaling in Dictyostelium?

Integrating DDB_G0268928 function into broader phospholipid signaling models requires a systems biology approach:

• Multi-omics data integration:

  • Combine transcriptomics data on expression patterns

  • Incorporate proteomics data on interaction partners

  • Add phosphoproteomics data on signaling dynamics

  • Include lipidomics data on phospholipid changes

  • Create correlation networks between datasets

• Pathway reconstruction and modeling:

  • Position DDB_G0268928 in relation to known phospholipid pathways

  • Define interactions with PtdInsP3 signaling components identified in previous studies

  • Develop mathematical models of pathway dynamics

  • Simulate perturbations and compare to experimental results

• Network analysis tools:

  • Perform enrichment analysis for functional categories

  • Identify network motifs and signaling hubs

  • Calculate centrality measures to determine pathway importance

  • Compare network architecture with other model organisms

• Experimental validation of model predictions:

  • Test predicted genetic interactions

  • Validate temporal dynamics of signaling events

  • Confirm feedback and feedforward regulation

  • Challenge the model with pharmacological inhibitors

• Visual representation of integrated data:

  Data Type	Integration Method	Visualization Approach
  Protein-protein interactions	Affinity purification-MS	Interaction network diagrams
  Genetic interactions	Epistasis analysis	Genetic interaction maps
  Phospholipid dynamics	Biosensor imaging	Spatiotemporal heatmaps
  Signaling kinetics	Time-course experiments	Pathway flux diagrams

This integrated approach will place DDB_G0268928 within the context of Dictyostelium phospholipid signaling, similar to how PH domain-containing proteins have been positioned within PtdInsP3-mediated signaling networks controlling directed cell migration .

What computational approaches can predict the impact of mutations in DDB_G0268928 on protein function and cellular phenotypes?

Computational approaches to predict mutation impacts on DDB_G0268928 function involve multiple layers of analysis:

• Sequence-based prediction methods:

  • SIFT, PolyPhen-2, and PROVEAN for evolutionary conservation analysis

  • MutPred for functional impact prediction

  • SNAP2 for predicting functional effects of non-synonymous mutations

  • Custom multiple sequence alignments with other PA-phosphatase family proteins

• Structure-based prediction approaches:

  • Homology modeling of DDB_G0268928 structure

  • Molecular dynamics simulations of wild-type and mutant proteins

  • Binding site analysis for substrate interaction

  • Energy calculations for stabilizing/destabilizing mutations

  • Similar to approaches used for analyzing PH domain interactions with PtdInsP3

• Systems biology predictions:

  • Network perturbation analysis based on protein interaction data

  • Flux balance analysis incorporating metabolic pathways

  • Agent-based modeling of cell migration with mutant parameters

  • Machine learning approaches trained on existing phenotypic data

• Integrated prediction workflows:

  Prediction Level	Methods	Output
  Protein stability	FoldX, I-Mutant	ΔΔG values
  Binding affinity	AutoDock, HADDOCK	Binding energy changes
  Cellular impact	Network analysis	Pathway perturbation scores
  Phenotypic outcome	Machine learning	Predicted phenotype severity

• Validation strategy:

  • Prioritize mutations for experimental testing

  • Compare computational predictions with experimental results

  • Refine models based on experimental feedback

  • Develop Dictyostelium-specific prediction parameters

These computational approaches provide a systematic framework for predicting how mutations in DDB_G0268928 might affect its function, interactions, and ultimately cellular phenotypes, guiding experimental design for more efficient characterization.

How can emerging technologies like advanced microscopy and single-cell analysis advance our understanding of DDB_G0268928 function?

Emerging technologies offer unprecedented opportunities to understand DDB_G0268928 function at higher resolution:

• Advanced microscopy approaches:

  • Super-resolution microscopy (STORM, PALM, SIM) to visualize DDB_G0268928 localization beyond diffraction limit

  • Lattice light-sheet microscopy for extended 3D imaging with reduced phototoxicity

  • FRET/FLIM microscopy to detect protein-protein interactions in live cells

  • Correlative light and electron microscopy (CLEM) to connect protein localization with ultrastructure

  • Similar to visualization techniques used for PH domain proteins at the leading edge in migrating Dictyostelium cells

• Single-cell analysis technologies:

  • Single-cell RNA-seq to identify cell state-dependent expression patterns

  • Mass cytometry to measure protein abundance across populations

  • Microfluidic devices for controlled single-cell manipulation

  • Live cell tracking during development and chemotaxis

• Biosensor development:

  • FRET-based sensors for DDB_G0268928 activity

  • PA biosensors to monitor substrate dynamics

  • Optogenetic tools to spatiotemporally control DDB_G0268928 activity

  • Split fluorescent protein systems to monitor protein interactions

• Multi-parameter imaging:

  Technology	Application	Advantage
  Multiplexed imaging	Simultaneous tracking of multiple signaling components	Correlation of dynamic processes
  Intravital imaging	In situ observation during development	Native microenvironment
  Light-sheet imaging	Long-term 4D imaging	Reduced phototoxicity
  Microfluidic devices	Precise gradient control	Quantitative chemotaxis analysis

• Computational image analysis:

  • Deep learning for cell segmentation and tracking

  • Quantitative analysis of protein localization dynamics

  • Correlation of morphological features with molecular data

  • Motion pattern recognition in chemotaxing cells

These technologies will provide unprecedented insights into how DDB_G0268928 functions at the single-cell and subcellular levels, similar to how advanced imaging revealed the dynamic localization patterns of PhdI to the leading edge and PhdB to the lagging edge in migrating cells .