Recombinant Dictyostelium discoideum PA-phosphatase related-family protein DDB_G0271516 (DDB_G0271516)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please specify it in your order notes. We will strive to accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
DDB_G0271516; PA-phosphatase related-family protein DDB_G0271516
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-366
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0271516
Target Protein Sequence
MENSGLLFNNDETIINKKIKKIIYENQYDKPLFYDIDLRKNNKKLIYLLDWFCVVVLLVI GSILLLKVPVRGRLFRLNDESISYPKLEEIIPLGLLIPLVTAVPFAMILLISIIFKRDIN DFHHSLLGFLQSISVTILLTGSFKVFIGGLRPSFLEFCKPTKESIVAGNPPVGYGAIYYD RSICTESEFIVNDGLSAYPSGHSSIAASCFGFLALYLLARLKCFDNRGHIIIYLLIIGCL ITAGLIGISRVADYRHTFLNVLAGWSIGLLISLSCYRLNFSSLFGRDNHISIHSHWLTYW DYHNNNNNSNSNNNNNNNNNNNNNNNNNNNNNNNKKDNINNNSTKTQNNFESYQSPNGIP LNELQN
Uniprot No.

Target Background

Database Links
Protein Families
PA-phosphatase related phosphoesterase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How does DDB_G0271516 relate to phosphatidylinositol phosphate metabolism in Dictyostelium?

Phosphatidylinositol phosphates (PIPs) serve as critical signaling molecules in Dictyostelium discoideum, particularly during phagocytosis and phagosome maturation. While the specific role of DDB_G0271516 is not fully characterized, its classification as a PA-phosphatase related protein suggests involvement in PIP dynamics. In Dictyostelium, PIP metabolism is well conserved compared to mammalian macrophages, with various phosphatases regulating the conversion between different PIP species .

Similar phosphatases, such as Dd5P4 (the Dictyostelium homolog of OCRL), are known to dephosphorylate PI(3,4,5)P3 into PI(3,4)P2 during phagocytic cup closure . DDB_G0271516 may play a role in similar phospholipid conversion pathways that are essential for membrane dynamics during cellular processes like phagocytosis, endocytosis, or development.

What expression systems are optimal for recombinant DDB_G0271516 production?

Escherichia coli has been successfully used as an expression system for recombinant DDB_G0271516, with the protein fused to an N-terminal His tag . When designing expression systems for this protein, consider the following methodological approach:

  • Vector selection: Use vectors with strong, inducible promoters (T7 or tac) for controlled expression

  • Tag positioning: N-terminal His tagging has proven effective for DDB_G0271516 expression and purification

  • Host strain selection: BL21(DE3) or derivatives are recommended for membrane-associated proteins

  • Codon optimization: Consider codon optimization for the E. coli expression system to enhance translation efficiency

For complex proteins with multiple transmembrane domains like DDB_G0271516, experimental optimization of expression conditions using factorial design approaches is highly recommended to maximize soluble protein yield .

How can I optimize soluble expression of DDB_G0271516 in E. coli?

Maximizing soluble expression of transmembrane proteins like DDB_G0271516 requires systematic optimization. A multivariant statistical experimental design approach is recommended over traditional univariant methods . Follow this methodological framework:

  • Identify critical variables: Temperature, inducer concentration, induction time, media composition

  • Design factorial experiments: Use fractional factorial design to reduce the number of experiments while maintaining statistical validity

  • Optimize culture conditions: Test combinations of:

    • Induction temperatures (16°C, 20°C, 25°C, 30°C)

    • IPTG concentrations (0.1, 0.5, 1.0 mM)

    • Post-induction incubation times (4, 8, 16, 24 hours)

    • Media formulations (LB, TB, 2xYT with glycerol supplementation)

This approach has successfully yielded high levels (up to 250 mg/L) of soluble recombinant protein in E. coli systems, which should be applicable to DDB_G0271516 expression .

ParameterLow LevelMid LevelHigh Level
Temperature (°C)162537
IPTG (mM)0.10.51.0
Induction time (h)41224
Media supplementsNoneGlycerol (0.5%)Glycerol (1%) + Glucose (0.5%)

What purification strategy yields highest purity for recombinant DDB_G0271516?

For His-tagged DDB_G0271516, a multi-step purification strategy is recommended:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Equilibrate column with Tris/PBS-based buffer (pH 8.0)

    • Apply clarified lysate

    • Wash with 20-50 mM imidazole

    • Elute with 250-300 mM imidazole step gradient

  • Secondary purification: Size exclusion chromatography

    • Further separate the protein from contaminants based on size

    • Use Tris/PBS-based buffer with 6% Trehalose, pH 8.0

  • Quality assessment: Analyze purity by SDS-PAGE (target >90% homogeneity)

For optimal storage, lyophilize the purified protein or store in Tris/PBS-based buffer with 6% Trehalose at -20°C/-80°C. Avoid repeated freeze-thaw cycles, and consider adding 5-50% glycerol for long-term storage .

How does DDB_G0271516 contribute to phagosome maturation in Dictyostelium discoideum?

While the specific role of DDB_G0271516 in phagosome maturation is not fully characterized, phosphatases play critical roles in this process in Dictyostelium discoideum. Phagosome maturation involves a tightly regulated sequence of phosphoinositide conversions that define compartmental identity.

In Dictyostelium, phosphatidylinositol dynamics during phagocytosis follow this pattern:

  • PI(4,5)P2 predominates at the plasma membrane

  • Upon receptor engagement, PI(4,5)P2 is phosphorylated to PI(3,4,5)P3

  • Phosphatases like Dd5P4 convert PI(3,4,5)P3 to PI(3,4)P2 during phagocytic cup closure

  • Subsequent dephosphorylation events continue throughout phagosome maturation

As a PA-phosphatase related protein, DDB_G0271516 may participate in these phosphoinositide interconversion processes. Research approaches to investigate its specific role should include:

  • Knockout or knockdown studies to observe effects on phagosome formation and maturation

  • Localization studies using fluorescently tagged DDB_G0271516 to track its position during phagocytosis

  • In vitro phosphatase assays with various phosphoinositide substrates

  • Interaction studies to identify binding partners involved in phagosome maturation

What mutational analysis approaches can elucidate DDB_G0271516 function in Dictyostelium development?

Systematic mutational analysis of DDB_G0271516 can provide insights into its functional domains and role in Dictyostelium development. Based on established approaches for studying developmental genes in Dictyostelium, consider these methodological steps:

  • Targeted gene disruption:

    • Create knockout mutants using homologous recombination

    • Characterize phenotypes during development, particularly during aggregation and mound formation

    • Assess if mutants display any of the established mound (mnd) phenotypes

  • Complementation studies:

    • Perform parasexual genetic analysis to establish complementation groups

    • Test if DDB_G0271516 mutants fall into existing mnd complementation groups

    • Assign the gene to appropriate linkage groups

  • Domain-specific mutations:

    • Target conserved catalytic residues in the phosphatase domain

    • Create point mutations in membrane-spanning regions

    • Generate truncation mutants to isolate functional domains

  • Phenotypic characterization:

    • Assess multicellular development using morphological markers

    • Perform neutral red staining to identify prestalk/prespore cell patterns

    • Analyze expression of developmental marker mRNAs

  • Synergy testing:

    • Mix mutant cells with wild-type cells to test for developmental rescue

    • Determine if mutants can be "carried through" development by wild-type cells

How can I determine the structural characteristics of DDB_G0271516?

Understanding the structural properties of DDB_G0271516 requires a multi-faceted approach:

  • Computational modeling:

    • Perform sequence alignment with known PA-phosphatases

    • Use homology modeling to predict tertiary structure

    • Apply transmembrane prediction algorithms to identify membrane-spanning domains

    • Predict functional sites based on conserved motifs

  • Experimental structure determination:

    • Express truncated soluble domains for crystallization

    • Consider NMR studies for smaller domains

    • For full-length protein, cryo-EM may be more suitable due to multiple transmembrane regions

  • Biophysical characterization:

    • Circular dichroism to assess secondary structure content

    • Size exclusion chromatography to determine oligomeric state

    • Thermal shift assays to evaluate stability under various conditions

  • Functional mapping:

    • Site-directed mutagenesis of predicted catalytic residues

    • Activity assays with phospholipid substrates

    • Binding studies with potential interaction partners

What statistical experimental design approaches optimize DDB_G0271516 functional studies?

When investigating DDB_G0271516 function, traditional univariant methods (changing one variable at a time) are less efficient than multivariant statistical approaches. Here's a recommended methodological framework:

  • Fractional factorial design:

    • Identify key variables affecting protein function (pH, temperature, ionic strength, cofactors)

    • Design experiments that test multiple variables simultaneously

    • Maintain orthogonality to ensure independent parameter estimation

  • Response surface methodology (RSM):

    • After identifying significant variables, use RSM to optimize conditions

    • Create mathematical models describing the relationships between variables

    • Identify optimal conditions for maximum activity or stability

  • Data analysis and modeling:

    • Apply analysis of variance (ANOVA) to determine statistically significant effects

    • Create predictive models for protein function under various conditions

    • Validate models with confirmation experiments

This approach provides several advantages:

  • Efficiently characterizes experimental error

  • Allows comparison of variable effects when normalized

  • Gathers high-quality information with fewer experiments

  • Enables optimization of complex multivariable systems

How can I troubleshoot expression and functional issues with recombinant DDB_G0271516?

When encountering difficulties with DDB_G0271516 expression or activity, implement this systematic troubleshooting approach:

  • Low expression yields:

    • Check codon optimization for E. coli expression

    • Test multiple expression strains (BL21, Rosetta, C41/C43 for membrane proteins)

    • Adjust induction parameters (temperature reduction to 16-20°C often helps)

    • Try fusion partners (SUMO, MBP) to enhance solubility

  • Protein inactivity:

    • Ensure proper buffer composition (phosphatases often require specific metal ions)

    • Verify protein folding using fluorescence spectroscopy or circular dichroism

    • Test protein in the presence of phospholipid membranes or micelles

    • Validate activity assay using commercially available phosphatases as positive controls

  • Protein instability:

    • Optimize storage conditions (add glycerol as cryoprotectant)

    • Test stabilizing additives (trehalose has shown effectiveness)

    • Avoid repeated freeze-thaw cycles

    • Consider storage at 4°C for short-term experiments

  • Purification difficulties:

    • Optimize lysis conditions for membrane proteins (detergent screening)

    • Adjust IMAC conditions (imidazole concentration, pH, salt concentration)

    • Try alternative affinity tags if His-tag is poorly accessible

    • Consider on-column refolding for proteins in inclusion bodies

What assays can best determine the activity of recombinant DDB_G0271516?

To characterize the phosphatase activity of DDB_G0271516, several complementary approaches are recommended:

  • Colorimetric phosphate release assays:

    • Use artificial substrates like p-nitrophenyl phosphate (pNPP)

    • Monitor release of inorganic phosphate using malachite green

    • Establish enzyme kinetics (Km, Vmax, kcat) under different conditions

  • Lipid-based activity assays:

    • Prepare liposomes containing fluorescently labeled phospholipid substrates

    • Monitor changes in fluorescence upon dephosphorylation

    • Use thin-layer chromatography to separate and quantify reaction products

  • Cellular assays:

    • Express DDB_G0271516 in DDB_G0271516-knockout Dictyostelium cells

    • Monitor rescue of phenotypic defects

    • Visualize phosphoinositide dynamics using fluorescent biosensors

  • Binding studies:

    • Perform protein-lipid overlay assays to determine substrate specificity

    • Use surface plasmon resonance to quantify binding affinities

    • Identify protein interaction partners through pull-down assays

For each assay, establish appropriate positive and negative controls, and ensure reproducibility through multiple independent experiments with statistical analysis of results.

How does DDB_G0271516 research contribute to understanding broader cellular processes?

Research on DDB_G0271516 extends beyond Dictyostelium biology and contributes to understanding fundamental cellular processes for several reasons:

  • Conservation of phosphoinositide signaling:

    • Phosphoinositide dynamics are highly conserved from Dictyostelium to mammals

    • Insights from DDB_G0271516 may apply to homologous mammalian phosphatases

    • Understanding this protein helps elucidate universal mechanisms of membrane trafficking

  • Model for phagocytosis studies:

    • Dictyostelium is an established model for studying phagocytosis

    • DDB_G0271516 research contributes to understanding immune cell functions

    • Macrophage phagocytosis follows similar phosphoinositide conversion patterns

  • Developmental biology insights:

    • Phosphatases play critical roles in multicellular development

    • DDB_G0271516 may link cell signaling to morphogenetic movements

    • Understanding these connections has implications for developmental biology across species

  • Methodological advancements:

    • Optimization approaches for DDB_G0271516 studies can be applied to other challenging proteins

    • Statistical experimental design principles demonstrated with this protein have broader applications

Researchers investigating DDB_G0271516 contribute to multiple fields simultaneously, from basic biochemistry to cell biology and developmental processes.

What are the most promising directions for future DDB_G0271516 research?

Based on current knowledge gaps and technological capabilities, these research directions offer the greatest potential:

  • Structure-function relationships:

    • Determine high-resolution structure using cryo-EM or X-ray crystallography

    • Map critical residues for catalysis through systematic mutagenesis

    • Connect structural features to cellular functions

  • Signaling network integration:

    • Identify upstream regulators and downstream effectors of DDB_G0271516

    • Map its position in phosphoinositide signaling networks

    • Determine how it coordinates with other phosphatases/kinases

  • Developmental regulation:

    • Characterize expression and activity changes during Dictyostelium development

    • Investigate potential roles in cell-type differentiation

    • Examine effects of DDB_G0271516 mutations on morphogenesis

  • Translational applications:

    • Explore potential of DDB_G0271516 homologs as therapeutic targets

    • Develop small molecule modulators of phosphatase activity

    • Apply insights to manipulate phagocytosis in immune disorders

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.