Recombinant Dictyostelium discoideum PA-phosphatase related-family protein DDB_G0284367 (DDB_G0284367)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
DDB_G0284367; PA-phosphatase related-family protein DDB_G0284367
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0284367
Target Protein Sequence
MIHRVSFYGKTTWFTKQHLIDWFLCLGIFVIESVLFNFVIPPFKRYEPESNISTNTFQLV QYPLLPDIVPVWLLMLIALGLPMVVFIGYYIKNRNSHDFHHAALGLFQAFTITMLFTDIL KVSAGRYRPDYGARVATGIEAVIREGRVSFPSGHSSVSFCGMTFLSFYLCGKTKVFLKDG GNILKALVCLCPFMISALVAVSRTVDYHHDFSDILAGSVIGLSIGVFVYFMNFNSLFSKE CSLPKNRINPHYARDGLLSAEYQSLSISSSL
Uniprot No.

Target Background

Database Links
Protein Families
PA-phosphatase related phosphoesterase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Dictyostelium discoideum PA-phosphatase related-family protein DDB_G0284367?

Recombinant Dictyostelium discoideum PA-phosphatase related-family protein DDB_G0284367 is a manufactured protein engineered to have the same amino acid sequence as the naturally occurring PA-phosphatase related-family protein found in the slime mold Dictyostelium discoideum. This protein is identified by UniProt ID Q54PR7 and consists of 271 amino acids in its full-length form. It belongs to the phosphatidic acid phosphatase (PA-phosphatase) related protein family, which plays roles in lipid metabolism and cellular signaling pathways. The recombinant version is typically expressed in E. coli with an N-terminal His tag to facilitate purification and downstream applications .

What are the optimal storage conditions for DDB_G0284367?

For optimal stability and preservation of biological activity, DDB_G0284367 should be stored according to these guidelines:

  • Long-term storage: Maintain at -20°C to -80°C, with -80°C preferred for extended periods

  • Working aliquots: Store at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as they can significantly compromise protein integrity

  • For lyophilized preparations: Store the powder at -20°C until reconstitution

The protein is typically supplied in a storage buffer containing Tris/PBS-based buffer with either 50% glycerol or 6% trehalose at pH 8.0, which helps maintain protein stability during freeze-thaw cycles .

How should DDB_G0284367 be reconstituted for experimental use?

For optimal reconstitution of lyophilized DDB_G0284367:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is commonly recommended)

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles

  • Verify protein concentration after reconstitution using spectrophotometric methods

This procedure helps maintain protein stability and activity while preventing contamination or degradation. The reconstituted protein should be handled with care, maintaining appropriate temperature conditions throughout experimental procedures .

How can researchers design experiments to study DDB_G0284367 function?

When designing experiments to study DDB_G0284367 function, researchers should consider:

  • Expression Analysis:

    • qRT-PCR to quantify mRNA expression levels

    • Western blotting using anti-His antibodies for detection of the recombinant protein

    • Immunofluorescence for subcellular localization studies

  • Functional Assays:

    • Phosphatase activity assays using appropriate substrates

    • Cell-based assays to monitor cellular responses upon protein addition

    • Knockout/knockdown studies in Dictyostelium cells to observe phenotypic changes

  • Interaction Studies:

    • Co-immunoprecipitation to identify binding partners

    • Yeast two-hybrid or pull-down assays to confirm direct interactions

    • Surface plasmon resonance for kinetic binding measurements

  • Structural Studies:

    • X-ray crystallography or NMR for detailed 3D structure

    • Circular dichroism for secondary structure analysis

An advanced experimental design would incorporate incomplete block or row-column designs for factor testing, as described in "Design and Analysis of Experiments, Volume 2: Advanced Experimental Design," to account for multiple variables that may affect protein function .

What bioassays are appropriate for measuring DDB_G0284367 activity?

Several bioassays can be employed to measure the activity of DDB_G0284367:

  • Enzymatic Activity Assays:

    • Phosphatase activity using colorimetric or fluorometric substrates

    • Measure release of phosphate groups using malachite green or similar assays

    • Kinetic analysis to determine Km and Vmax values

  • Cell-Based Functional Assays:

    • Cell proliferation assays to determine ED50 (effective dose that induces 50% of maximum response)

    • Chemotaxis assays if the protein influences cell migration

    • Cell signaling assays monitoring downstream pathway activation

  • Binding Assays:

    • ELISA-based binding assays to potential substrates or interacting partners

    • Fluorescence polarization to quantify binding affinities

The biological activity should be expressed as ED50, representing the concentration of DDB_G0284367 that induces 50% of maximum response in relevant bioassays. Controls should include heat-inactivated protein and structurally similar proteins to ensure specificity of observed effects .

How can researchers validate antibodies for DDB_G0284367 detection?

Thorough antibody validation for DDB_G0284367 detection should follow these steps:

  • Initial Characterization:

    • Test antibody against purified recombinant DDB_G0284367 protein

    • Verify specificity using SDS-PAGE and Western blotting

    • Confirm expected molecular weight (approximately 30 kDa plus tag size)

  • Specificity Testing:

    • Use knockout/knockdown samples as negative controls

    • Test reactivity against closely related PA-phosphatase family proteins

    • Perform peptide competition assays to confirm epitope specificity

  • Application-Specific Validation:

    • For Western blotting: Verify single band at expected size, appropriate dilution

    • For immunoprecipitation: Confirm pull-down efficiency with mass spectrometry

    • For immunofluorescence: Verify expected subcellular localization

    • For ELISA: Establish standard curves and determine detection limits

  • Cross-Validation:

    • Compare results using multiple antibodies targeting different epitopes

    • Correlate protein detection with mRNA expression data

Antibody validation should be documented thoroughly with appropriate controls to ensure reproducibility across different experimental systems .

How does DDB_G0284367 structure compare to other PA-phosphatase family proteins?

The structural comparison of DDB_G0284367 with other PA-phosphatase family proteins reveals important insights:

  • Transmembrane Domain Analysis:

    • DDB_G0284367 contains multiple hydrophobic regions consistent with transmembrane domains

    • Amino acid sequence analysis suggests 6-8 potential membrane-spanning regions

    • The protein likely adopts a multi-pass membrane protein topology similar to other PA-phosphatases

  • Conserved Catalytic Domains:

    • Contains the characteristic phosphatase catalytic motif

    • Key catalytic residues are positioned similarly to other family members

    • Specific residues (particularly at positions 151-180) show conservation across species

  • Structural Differences:

    • DDB_G0284367 possesses unique N-terminal regions not found in mammalian homologs

    • The C-terminal domain shows higher variability compared to core catalytic regions

    • Species-specific insertions may confer specialized functions in Dictyostelium

Homology modeling suggests that despite sequence divergence, the tertiary structure of the catalytic core maintains conservation, highlighting functional importance across evolutionary distance. The enzyme's membrane topology likely influences substrate accessibility and specificity .

What experimental approaches can reveal DDB_G0284367 interacting partners?

To comprehensively identify and characterize DDB_G0284367 interacting partners, researchers should employ multiple complementary approaches:

  • Affinity-Based Methods:

    • His-tag pull-down assays using recombinant DDB_G0284367 as bait

    • Co-immunoprecipitation followed by mass spectrometry

    • Proximity labeling techniques (BioID or APEX2) to capture transient interactions

    • Crosslinking mass spectrometry for structural interaction analysis

  • Library Screening Approaches:

    • Yeast two-hybrid screening against Dictyostelium cDNA libraries

    • Phage display to identify peptide motifs that interact with DDB_G0284367

    • Protein arrays to test interactions with known signaling proteins

  • In vivo Validation Methods:

    • Bimolecular fluorescence complementation (BiFC) in Dictyostelium cells

    • Förster resonance energy transfer (FRET) to confirm proximity in living cells

    • Co-localization studies using fluorescently tagged proteins

  • Functional Validation:

    • Mutational analysis of binding interfaces to disrupt specific interactions

    • Competitive binding assays to determine relative affinities

    • Phenotypic rescue experiments in knockout cells

These approaches should be conducted using symmetrical, asymmetrical, or fractional factorial design principles to efficiently explore multiple interaction conditions while minimizing experimental bias .

How can CRISPR/Cas9 be used to study DDB_G0284367 function in Dictyostelium discoideum?

CRISPR/Cas9 genome editing offers powerful approaches to study DDB_G0284367 function in Dictyostelium discoideum:

  • Knockout Generation Strategy:

    • Design sgRNAs targeting exonic regions (preferably early exons)

    • Optimize Cas9 expression for Dictyostelium codon usage

    • Use homology-directed repair templates to introduce selection markers

    • Screen clones using PCR, sequencing, and Western blot validation

  • Domain Mutagenesis Approach:

    • Target catalytic residues for point mutations via HDR

    • Create truncation mutants to study domain-specific functions

    • Engineer tag knock-ins for endogenous protein tracking

  • Regulatory Element Manipulation:

    • Target promoter regions to alter expression patterns

    • Create conditional expression systems using inducible promoters

    • Engineer reporter knock-ins to monitor native expression dynamics

  • Experimental Validation:

    • Phenotypic characterization during Dictyostelium development

    • Chemotaxis and cell migration assays in mutant strains

    • Lipid metabolism analysis to assess phosphatase activity effects

    • Transcriptomic profiling to identify downstream pathway perturbations

The effectiveness of CRISPR editing in Dictyostelium can be enhanced using Cas9 ribonucleoprotein delivery methods followed by selection with appropriate antibiotics. This approach allows for precise genomic modifications while minimizing off-target effects .

How should researchers analyze enzymatic activity data for DDB_G0284367?

Proper analysis of DDB_G0284367 enzymatic activity data requires rigorous quantitative approaches:

  • Kinetic Parameter Determination:

    • Measure initial reaction rates across substrate concentration range

    • Fit data to appropriate enzyme kinetic models (Michaelis-Menten, allosteric)

    • Calculate Km, Vmax, kcat, and catalytic efficiency (kcat/Km)

    • Compare parameters with other PA-phosphatase family members

  • Statistical Analysis Framework:

    • Perform experiments with minimum n=3 biological replicates

    • Apply appropriate statistical tests based on data distribution

    • Use ANOVA for multiple condition comparisons followed by post-hoc tests

    • Report p-values and confidence intervals for all parameters

  • Inhibition Studies Analysis:

    • Determine IC50 values for potential inhibitors

    • Calculate Ki values and characterize inhibition mechanisms

    • Create Dixon or Lineweaver-Burk plots to distinguish inhibition types

  • Data Visualization:

    • Present enzyme kinetics using substrate-velocity curves

    • Create Lineweaver-Burk or Eadie-Hofstee plots for linear transformations

    • Include error bars representing standard deviation or standard error

For robust analysis, advanced experimental designs incorporating randomized block or Latin square approaches can help control for variations in experimental conditions while maximizing statistical power in enzymatic assays .

What troubleshooting approaches help resolve inconsistent DDB_G0284367 activity results?

When faced with inconsistent DDB_G0284367 activity results, researchers should systematically troubleshoot using this decision tree:

  • Protein Quality Assessment:

    • Verify protein purity via SDS-PAGE (should be >90%)

    • Check for protein degradation by Western blot

    • Assess aggregation state through size exclusion chromatography

    • Confirm proper folding using circular dichroism

    • Consider fresh reconstitution from lyophilized stock

  • Assay Condition Optimization:

    • Test multiple buffer systems (pH 6.0-8.5)

    • Evaluate different ionic strengths (50-300 mM)

    • Optimize divalent cation concentrations (especially Mg²⁺, Ca²⁺)

    • Assess temperature sensitivity (4°C to 37°C range)

    • Determine optimal protein concentration ranges

  • Substrate Considerations:

    • Verify substrate purity and preparation

    • Test substrate solubility in assay conditions

    • Consider alternative substrate preparations

    • Evaluate potential substrate competition or inhibition

  • Systematic Error Identification:

    • Implement positive and negative controls in each experiment

    • Use internal standards for normalization

    • Consider plate position effects in multi-well formats

    • Evaluate operator variability through cross-validation

Implementing a robust design of experiments (DOE) approach as outlined in advanced experimental design literature can systematically identify critical factors affecting variability in DDB_G0284367 activity assays .

How can researchers interpret contradictory results regarding DDB_G0284367 function?

When confronted with contradictory results regarding DDB_G0284367 function, researchers should follow this interpretive framework:

  • Methodological Differences Assessment:

    • Compare experimental conditions between contradictory studies

    • Evaluate protein preparations (full-length vs. truncated constructs)

    • Assess tag positions and their potential functional interference

    • Consider cell type or model system differences

    • Analyze assay sensitivity and specificity limitations

  • Biological Context Considerations:

    • Evaluate developmental stage or cellular differentiation states

    • Consider post-translational modifications affecting function

    • Assess protein localization differences between studies

    • Analyze presence of interacting partners or regulators

  • Data Integration Approaches:

    • Perform meta-analysis of available quantitative data

    • Weight evidence based on methodological rigor

    • Develop testable hypotheses that reconcile contradictions

    • Design discriminating experiments to resolve discrepancies

  • Resolution Strategies:

    • Direct replication of contradictory experiments

    • Collaborative cross-laboratory validation

    • Development of improved or orthogonal assay systems

    • Publication of detailed protocols to enhance reproducibility

How can computational approaches enhance understanding of DDB_G0284367 structure-function relationships?

Computational approaches offer powerful tools for elucidating DDB_G0284367 structure-function relationships:

  • Structure Prediction Approaches:

    • Apply AlphaFold2 or RoseTTAFold for accurate 3D structure prediction

    • Validate models using molecular dynamics simulations (100+ ns)

    • Identify conserved structural motifs through comparative modeling

    • Predict membrane topology using specialized algorithms (TMHMM, Phobius)

  • Functional Site Prediction:

    • Identify putative catalytic residues through structural alignment

    • Predict substrate binding pockets using CASTp or SiteMap

    • Calculate electrostatic surface potentials to identify interaction regions

    • Perform in silico mutagenesis to evaluate residue contributions

  • Molecular Dynamics Applications:

    • Simulate protein behavior in membrane environments

    • Analyze conformational changes upon substrate binding

    • Identify allosteric communication pathways within the protein

    • Calculate binding free energies for potential inhibitors

  • Network Analysis Methods:

    • Construct protein-protein interaction networks in Dictyostelium

    • Identify pathway connections through functional enrichment

    • Perform co-expression analysis across developmental stages

    • Apply systems biology approaches to contextualize function

These computational approaches can guide experimental design by generating testable hypotheses about structure-function relationships, potentially accelerating discovery while reducing experimental costs .

What methodologies are suitable for studying DDB_G0284367 in membrane environments?

Investigating DDB_G0284367 in membrane environments requires specialized methodologies:

  • Membrane Protein Preparation Techniques:

    • Detergent-based extraction optimized for multi-pass membrane proteins

    • Nanodiscs or liposomes for reconstitution in native-like environments

    • Styrene maleic acid lipid particles (SMALPs) for native membrane extraction

    • Cell-free expression systems with membrane mimetics

  • Biophysical Characterization Methods:

    • Solid-state NMR for structural analysis in lipid environments

    • Hydrogen/deuterium exchange mass spectrometry for dynamics

    • Electron paramagnetic resonance (EPR) for distance measurements

    • Fluorescence-based techniques for orientation and movement

  • Functional Analysis in Membranes:

    • Proteoliposome-based activity assays with defined lipid composition

    • Giant unilamellar vesicle (GUV) systems for visualization

    • Planar lipid bilayers for electrophysiological measurements

    • Native membrane vesicle preparations from Dictyostelium

  • Advanced Imaging Approaches:

    • Single-molecule localization microscopy for distribution analysis

    • Cryo-electron microscopy for structural determination

    • FRAP (Fluorescence Recovery After Photobleaching) for mobility

    • Super-resolution microscopy for nanoscale organization

These methodologies should be implemented with careful attention to lipid composition, as PA-phosphatase family proteins often show lipid-dependent activity and structural changes that are critical to understanding their biological functions .

What are the emerging technologies for studying DDB_G0284367 regulation in vivo?

Cutting-edge technologies offer new opportunities for studying DDB_G0284367 regulation in vivo:

  • Real-time Imaging Technologies:

    • CRISPR knock-in of fluorescent tags for endogenous visualization

    • Optogenetic tools for spatiotemporal activity control

    • Genetically encoded biosensors for downstream signaling

    • Light-sheet microscopy for whole-organism imaging during development

  • Single-cell Analysis Approaches:

    • Single-cell RNA-seq to capture expression heterogeneity

    • CyTOF mass cytometry for protein-level quantification

    • Spatial transcriptomics to map expression in tissue context

    • Microfluidic devices for controlled single-cell manipulation

  • Genome-wide Regulatory Analysis:

    • CUT&RUN or CUT&Tag for transcription factor binding

    • HiChIP for enhancer-promoter interaction mapping

    • ATAC-seq for chromatin accessibility

    • RNA-Protein interaction mapping (CLIP-seq variants)

  • Metabolic Analysis Tools:

    • Lipidomics to profile changes in phospholipid metabolism

    • Metabolic flux analysis using stable isotope tracers

    • Real-time metabolite sensing with genetically encoded sensors

    • Spatial metabolomics for subcellular metabolite localization

These emerging technologies enable researchers to study DDB_G0284367 function in unprecedented detail within its native cellular context, providing insights into regulatory mechanisms that were previously inaccessible with traditional biochemical and molecular approaches .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.