Recombinant Dictyostelium discoideum PEMT/PEM2 methyltransferase family protein (DDB_G0289645)

Shipped with Ice Packs
In Stock

Description

Enzymatic Classification

PEMT/PEM2 methyltransferase family protein functions as a phosphatidylethanolamine N-methyltransferase (EC 2.1.1.17) and phosphatidyl-N-methylethanolamine N-methyltransferase (EC 2.1.1.71) . These enzymatic classifications indicate its role in transferring methyl groups to phospholipid substrates, particularly in the conversion pathway from phosphatidylethanolamine (PE) to phosphatidylcholine (PC).

Metabolic Pathway Integration

According to KEGG pathway analysis, this protein is involved in:

PathwayKEGG IdentifierDescription
Glycerophospholipid metabolismddi00564Involved in phospholipid biosynthesis and modification
Metabolic pathwaysddi01100Part of the broader cellular metabolic network
Biosynthesis of secondary metabolitesddi01110Contributes to the production of bioactive molecules

The protein is specifically associated with the module ddi_M00091, which represents the phosphatidylcholine biosynthesis pathway where phosphatidylethanolamine is converted to phosphatidylcholine . This conversion is critical for membrane structure and function in eukaryotic cells.

Expression Systems

The recombinant form of Dictyostelium discoideum PEMT/PEM2 methyltransferase family protein is typically produced using various expression systems:

  1. Escherichia coli expression system - The protein is frequently expressed in E. coli with an N-terminal histidine tag for purification purposes .

  2. Cell-free expression systems - These systems are used for rapid production without the limitations of cell-based methods .

Protein Modifications

The recombinant protein is commonly produced with tag modifications to facilitate purification and detection:

  • N-terminal histidine (His) tag

  • Other tag types may be determined during the production process depending on specific research requirements

Physical Characteristics

The recombinant PEMT/PEM2 protein typically exhibits the following physical properties:

PropertyDescription
AppearanceLyophilized powder
Purity≥90% as determined by SDS-PAGE analysis
SolubilitySoluble in aqueous buffers after proper reconstitution
Molecular WeightCorresponds to the predicted weight based on 200 amino acids plus any tags

Reconstitution Guidelines

To properly reconstitute the lyophilized protein:

  1. Briefly centrifuge the vial prior to opening to bring contents to the bottom

  2. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Add glycerol to a final concentration of 5-50% for long-term storage

  4. The default final concentration of glycerol is typically 50%

Biochemical Studies

The recombinant PEMT/PEM2 methyltransferase family protein is valuable for studying:

  • Enzymatic mechanisms of phospholipid methylation

  • Structure-function relationships of methyltransferases

  • Biochemical characterization of phospholipid modification pathways

Developmental Biology

Given the importance of Dictyostelium discoideum as a model organism for studying development, this protein may hold significance in developmental processes:

Dictyostelium discoideum exhibits DNA methylation patterns that change during development, and methyltransferases play crucial roles in this process . While direct evidence for the specific role of pemtB in development is limited in the current literature, the broader context suggests that methyltransferases contribute to the regulation of gene expression during Dictyostelium development .

Comparative Biochemistry

The study of this protein allows for comparative analysis with similar enzymes from other organisms:

Dictyostelium discoideum contains multiple genes encoding phosphatidylethanolamine N-methyltransferases, including pemtA (DDB_G0282527) and pemtB (DDB_G0289645) . This gene family enables researchers to study the evolution and functional specialization of phospholipid methyltransferases across different species and within Dictyostelium itself.

Relation to Other Proteins in Dictyostelium discoideum

The Dictyostelium discoideum genome contains multiple phosphatidylethanolamine N-methyltransferase genes that share functional similarities:

  1. pemtA (DDB_G0282527) - Another phosphatidylethanolamine N-methyltransferase with 213 amino acids

  2. DDB_G0272678 - A hypothetical protein also classified as a phosphatidylethanolamine N-methyltransferase

These proteins likely arose from gene duplication events and may have evolved specialized functions within Dictyostelium cells, contributing to the organism's unique phospholipid metabolism and membrane composition.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your desired tag type for preferential development.
Synonyms
pemtB; DDB_G0289645; Phosphatidylethanolamine N-methyltransferase B; PEAMT; PEMT; Phospholipid methyltransferase B; PLMT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
pemtB
Target Protein Sequence
MEKGLSSDLIIAFVAIVLHVVNYNVTAQFEYKTRYFTKLIGRNAIYYYAVFLIISALIRD HFINVAVLSDKDSIILFPTEIANMIGDSCFIFGILLNIWTLKALGIKGMYNGDSFGHIMD SPVTGGPYQFFSDPQYVGTTIAALGVAIRNQSIYGFLCTILVGVVFYISATFVETPHLKN IYSNRSYSKINFKNLKSLKN
Uniprot No.

Target Background

Function

This recombinant Dictyostelium discoideum PEMT/PEM2 methyltransferase family protein (DDB_G0289645) catalyzes the three sequential steps in phosphatidylcholine biosynthesis methylation pathway. These steps involve the SAM-dependent methylation of phosphatidylethanolamine (PE) to phosphatidylmonomethylethanolamine (PMME), PMME to phosphatidyldimethylethanolamine (PDME), and finally PDME to phosphatidylcholine (PC).

Database Links
Protein Families
Class VI-like SAM-binding methyltransferase superfamily, PEMT/PEM2 methyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Mitochondrion membrane; Multi-pass membrane protein.

Q&A

How is DDB_G0289645 related to the methyltransferase DDB_G0272678?

DDB_G0289645 (pemtB) and DDB_G0272678 are functionally related methyltransferases in Dictyostelium discoideum that participate in phospholipid metabolism. While DDB_G0289645 is classified as a phosphatidyl-N-methylethanolamine N-methyltransferase (EC 2.1.1.71), DDB_G0272678 functions as a phosphatidylethanolamine N-methyltransferase (EC 2.1.1.17) . Both enzymes contribute to the phosphatidylcholine biosynthesis pathway (module M00091: PE => PC), but they likely catalyze different methylation steps in this process. DDB_G0272678 contains recognized protein domains including PEMT and NopRA1, suggesting structural features that enable its methyltransferase activity . The sequential action of these enzymes allows for the stepwise methylation of phosphatidylethanolamine to phosphatidylcholine, which is essential for membrane biogenesis. Understanding the relationship between these enzymes provides insights into the regulation of phospholipid metabolism in D. discoideum and potentially other eukaryotic systems.

Why is Dictyostelium discoideum a valuable model for studying methyltransferases like DDB_G0289645?

Dictyostelium discoideum offers several distinct advantages for studying methyltransferases like DDB_G0289645. As a social amoeba, D. discoideum possesses a unique combination of unicellular growth and multicellular development, allowing researchers to investigate protein function across different biological contexts . The organism can be rapidly grown to high cell densities in inexpensive media, facilitating biochemical analyses that require substantial amounts of cellular material . Its genome is fully sequenced and remarkably compact, containing genes with significant homology to those in higher eukaryotes, including humans, while lacking the redundancy often encountered in mammalian systems. D. discoideum is highly amenable to genetic manipulation, with gene disruption via homologous recombination working at efficiencies as high as 90% . This allows for precise genetic studies of methyltransferases, including serial gene disruptions using systems like Cre-loxP . Additionally, its haploid nature simplifies the interpretation of mutant phenotypes, making it an excellent model for studying enzyme function. The organism's amoeboid lifestyle more closely resembles animal cells than yeast in several important aspects, including membrane flexibility and active processes like phagocytosis and pinocytosis .

What purification strategies yield the highest purity and activity for DDB_G0289645?

Purification of recombinant DDB_G0289645 requires a multi-step approach that preserves enzymatic activity while achieving high purity. Begin with affinity chromatography using an N-terminal or C-terminal tag (His6, GST, or FLAG) selected during the cloning design. For membrane-associated methyltransferases like DDB_G0289645, include 0.5-1% non-ionic detergents (Triton X-100 or CHAPS) in lysis buffers to solubilize the protein. After initial capture, perform an on-column detergent exchange to a milder detergent like 0.1% DDM to maintain stability. Incorporate 10-15% glycerol and 1-5 mM DTT or 2-mercaptoethanol in all buffers to protect the enzyme's active site. Following affinity purification, employ ion exchange chromatography (typically Q-Sepharose) at pH 7.5-8.0, as methyltransferases often have an acidic isoelectric point. For final polishing and buffer exchange, size exclusion chromatography using Superdex 200 columns works well, also confirming the protein's oligomeric state. Throughout purification, monitor enzyme activity using a methyltransferase assay that measures transfer of methyl groups from S-adenosylmethionine (SAM) to phosphatidylethanolamine substrates. Calculate specific activity (nmol/min/mg) at each purification step to track enrichment and preserve the most active fractions. Store the purified enzyme at -80°C in small aliquots with 25% glycerol to prevent freeze-thaw damage. This strategy typically yields protein with >90% purity and specific activity suitable for structural and biochemical characterization.

How can researchers generate knockout or knockdown models of DDB_G0289645 in Dictyostelium?

To generate knockout models of DDB_G0289645 in Dictyostelium, researchers can utilize homologous recombination, which works with remarkably high efficiency (up to 90%) in this organism . The procedure begins with designing a knockout construct containing a selection marker (typically blasticidin S resistance cassette) flanked by 5' and 3' homologous regions (1-2 kb each) of the DDB_G0289645 gene. After transformation by electroporation (using conditions: 0.75-1.0 kV, 25 μF capacitance, two pulses), cells are selected with blasticidin S (typically 5-10 μg/ml). Successful gene disruption can be verified through genomic PCR using primers that span the integration site, Southern blotting, and RT-PCR to confirm the absence of DDB_G0289645 transcript. For essential genes where knockout might be lethal, a conditional knockdown approach is preferable. This can be achieved using an inducible antisense or RNAi construct under the control of a tetracycline-regulated promoter. Alternatively, researchers can implement the Cre-loxP system for creating multiple gene disruptions, particularly valuable when studying gene families . This approach allows for the recycling of selection markers by flanking them with loxP sites that can be excised by transient Cre recombinase expression. For functional rescue experiments, wild-type or mutant versions of DDB_G0289645 can be reintroduced using extrachromosomal vectors under constitutive or inducible promoters, similar to the approach used with the Dp dmtA methyltransferase described in study .

What biochemical assays can measure the methyltransferase activity of DDB_G0289645?

Several complementary biochemical assays can effectively measure the methyltransferase activity of DDB_G0289645. The most direct approach is a radiometric assay using S-adenosyl-L-[methyl-³H]methionine (³H-SAM) as the methyl donor and phosphatidylethanolamine as the substrate. In this protocol, the reaction mixture (typically 100 μL) contains 50 mM Tris-HCl (pH 8.0), 5 mM MgCl₂, 100 μM phosphatidylethanolamine (prepared as liposomes or in mixed micelles with Triton X-100), 1-10 μg purified enzyme, and 2 μCi ³H-SAM (specific activity >80 Ci/mmol). After incubation at 30°C for 30-60 minutes, the reaction is terminated by adding chloroform:methanol (2:1 v/v). The organic phase containing radiolabeled phospholipids is washed, dried, and quantified by liquid scintillation counting. Alternatively, a non-radioactive coupled enzyme assay can monitor S-adenosylhomocysteine (SAH) production using SAH hydrolase and adenosine deaminase, with spectrophotometric detection at 265 nm. For high-throughput screening, commercial methyltransferase assay kits based on fluorescence or luminescence detection of SAH are available. LC-MS/MS analysis provides the most detailed characterization by directly quantifying the methylated phospholipid products. These methods allow determination of key kinetic parameters including Km for both SAM and phospholipid substrates, Vmax, kcat, and substrate specificity. Researchers should also investigate pH optima (typically pH 7.5-8.5), temperature sensitivity, and cofactor requirements, particularly divalent cations like Mg²⁺ that often enhance methyltransferase activity.

How can researchers determine the substrate specificity of DDB_G0289645?

Determining substrate specificity of DDB_G0289645 requires a systematic approach examining both methyl donor and phospholipid substrate preferences. For methyl donor analysis, compare the enzyme's activity with S-adenosylmethionine (SAM) against structural analogs like S-adenosylethionine or sinefungin using the radiometric or coupled assays described previously. To investigate phospholipid substrate specificity, prepare a panel of potential substrates including phosphatidylethanolamine (PE) with varying fatty acid compositions (16:0/18:1, 18:0/18:1, 18:0/20:4, etc.) and related phospholipids such as lysophosphatidylethanolamine, plasmalogen PE, and phosphatidylmonomethylethanolamine (PMME). Test each substrate at standardized concentrations (typically 50-100 μM) while maintaining constant enzyme and SAM concentrations. Employ thin-layer chromatography (TLC) with phospholipid-specific staining or radioactive detection to separate and identify reaction products. For more precise characterization, use liquid chromatography coupled with mass spectrometry (LC-MS/MS) to identify and quantify the methylated products, which allows determination of position-specific methylation patterns. Michaelis-Menten kinetic analysis with various substrates provides comparative Km and Vmax values that reflect substrate preference. Additionally, computational modeling using homology models of DDB_G0289645 based on related methyltransferases can predict substrate binding modes and interactions. The substrate specificity profile should be compared with that of the related methyltransferase DDB_G0272678 to determine their complementary or redundant roles in phospholipid metabolism .

What structural domains and catalytic residues are critical for DDB_G0289645 function?

The functional architecture of DDB_G0289645 comprises several key domains and catalytic residues that are essential for its methyltransferase activity. Based on analysis of related methyltransferases, DDB_G0289645 likely contains a SAM-dependent methyltransferase fold characterized by a Rossmann-like structure with alternating β-strands and α-helices forming a central β-sheet. The critical SAM-binding motif typically includes a conserved glycine-rich sequence (G-X-G-X-G) that interacts with the methionine portion of SAM. The catalytic domain likely contains a set of highly conserved residues including an invariant glutamate or aspartate that serves as a general base for catalysis, assisting in the deprotonation of the substrate nitrogen prior to methyl transfer. For mapping these critical residues, perform site-directed mutagenesis of predicted catalytic amino acids (particularly E/D, H, R, and Y residues in conserved motifs) followed by activity assays to measure the impact on enzyme function. Complementary approaches include chemical modification studies using group-specific reagents (such as diethylpyrocarbonate for histidine residues) and photoaffinity labeling with SAM analogs to identify binding residues. To study domain organization, generate truncated proteins that isolate specific domains and assess their individual activities. For definitive structural characterization, pursue X-ray crystallography of the purified protein in complex with SAM and substrate analogs, or employ cryoEM for larger complexes. Compare the structural features with those of the related methyltransferase DDB_G0272678, which participates in the same phosphatidylcholine biosynthesis pathway , to identify both shared and distinct elements that determine their specific functions.

How does phospholipid methylation by DDB_G0289645 influence membrane dynamics in Dictyostelium?

Phospholipid methylation catalyzed by DDB_G0289645 significantly influences membrane dynamics in Dictyostelium through multiple biophysical and biochemical mechanisms. The sequential methylation of phosphatidylethanolamine (PE) to phosphatidylcholine (PC) progressively alters the head group size and hydrogen-bonding capacity of these phospholipids, directly affecting membrane curvature, fluidity, and lateral organization. To investigate these effects, researchers should employ multiple complementary approaches. Fluorescence recovery after photobleaching (FRAP) with fluorescently-labeled lipids can measure changes in membrane fluidity in DDB_G0289645 knockout versus wild-type cells. Differential scanning calorimetry (DSC) of isolated membrane fractions provides quantitative data on phase transition temperatures that reflect membrane packing. Phospholipid methylation also impacts membrane protein function by altering the lipid microenvironment. This can be assessed using proteomic analysis of detergent-resistant membrane fractions from wild-type and knockout cells to identify proteins whose membrane association is methylation-dependent. Additionally, researchers should analyze transmembrane signaling pathways, particularly those dependent on lipid rafts, as these microdomains are sensitive to phospholipid composition. Given Dictyostelium's role as a model for chemotaxis and cell motility , particular attention should be paid to the effects of DDB_G0289645 disruption on actin cytoskeleton dynamics and cell migration, which depend on proper membrane-cytoskeleton interactions. Time-lapse microscopy of cells expressing GFP-tagged cytoskeletal markers can reveal how altered membrane composition affects these processes. Finally, lipidomic analysis using high-resolution mass spectrometry can provide comprehensive profiles of membrane phospholipid changes resulting from DDB_G0289645 manipulation.

What role does DDB_G0289645 play during the developmental cycle of Dictyostelium discoideum?

The role of DDB_G0289645 during Dictyostelium development likely involves critical phospholipid remodeling events that facilitate the transition from unicellular growth to multicellular morphogenesis. This hypothesis can be investigated through a temporal expression analysis of DDB_G0289645 across developmental stages using RT-qPCR and Western blotting with stage-specific samples. Researchers should generate DDB_G0289645 knockout strains using homologous recombination techniques and comprehensively characterize their developmental phenotypes. Time-lapse microscopy can document potential defects in stream formation, aggregation, slug migration, or fruiting body morphogenesis. Given that developmental transitions in Dictyostelium involve substantial membrane remodeling, lipidomic analysis of wild-type versus knockout cells at key developmental timepoints would reveal specific phospholipid alterations. The methylation of phosphatidylethanolamine to phosphatidylcholine may be particularly important during starvation-induced development, as membrane composition changes could affect signaling pathways crucial for development. To test this, researchers should examine cAMP-dependent signaling in DDB_G0289645-deficient cells, focusing on receptor localization and downstream pathway activation. Additionally, cell-type differentiation assays using cell-type specific markers would determine if DDB_G0289645 influences the spore/stalk cell ratio, which is normally maintained at around 80%/20% . For rescue experiments, reintroduce wild-type DDB_G0289645 under developmental stage-specific promoters to determine when the enzyme's activity is most critical. Comparative analysis with the developmental methylation patterns in related Dictyostelium species, drawing on approaches similar to those used for studying DNA methylation , could provide evolutionary context for DDB_G0289645 function in multicellular development.

How do researchers integrate computational approaches to predict interactions between DDB_G0289645 and potential inhibitors?

Integrating computational approaches to predict interactions between DDB_G0289645 and potential inhibitors begins with developing an accurate structural model. In the absence of a crystal structure, construct a homology model using related methyltransferases as templates, with particular attention to the SAM-binding pocket and substrate recognition regions. Molecular dynamics simulations (100-500 ns) with explicit solvent are essential to refine this model, especially for capturing flexible loop regions that may participate in substrate binding. For virtual screening, prepare a diverse library of potential inhibitors including established methyltransferase inhibitors (sinefungin, adenosine dialdehyde), SAM analogs, and compounds from natural product databases. Employ multiple docking algorithms (Glide, AutoDock Vina, GOLD) with consensus scoring to rank compounds based on predicted binding affinity. Pharmacophore modeling based on known methyltransferase inhibitors can further refine the screening process by identifying essential chemical features for inhibition. Molecular mechanics/generalized Born surface area (MM/GBSA) calculations provide more accurate binding energy estimates for top-ranking compounds. For the most promising candidates, perform free energy perturbation (FEP) calculations to obtain rigorous binding affinity predictions. Machine learning approaches can also be valuable—train models using activity data from related methyltransferases to predict inhibitory potency of new compounds. Prioritize compounds for experimental validation based on predicted binding affinity, synthetic accessibility, and physicochemical properties suitable for cellular uptake. The computational pipeline should include molecular interaction fingerprints to analyze specific protein-ligand contacts that can guide subsequent medicinal chemistry optimization. This integrated computational approach significantly enhances the efficiency of identifying potent and selective inhibitors of DDB_G0289645 for use as chemical probes in biological studies.

How can researchers utilize DDB_G0289645 as a model for understanding human phospholipid methyltransferases?

Researchers can effectively utilize DDB_G0289645 as a model for understanding human phospholipid methyltransferases through comparative functional genomics approaches. Despite evolutionary distance, core catalytic mechanisms of methyltransferases are often conserved, making Dictyostelium an excellent simplified system for mechanistic studies. To leverage this model, researchers should first perform detailed sequence and structural comparisons between DDB_G0289645 and human phosphatidylethanolamine N-methyltransferase (PEMT), identifying conserved catalytic residues and substrate-binding motifs. The simplified genetics of Dictyostelium allows for more straightforward functional studies than mammalian systems; knockout strains of DDB_G0289645 can be readily generated using homologous recombination with efficiencies up to 90% , followed by lipidomic profiling to determine specific phospholipid alterations. Complementation experiments introducing human PEMT into DDB_G0289645-null Dictyostelium can assess functional conservation. Dictyostelium's amenability to microscopy facilitates subcellular localization studies of fluorescently-tagged methyltransferases, revealing potential compartment-specific functions. For pharmacological studies, inhibitors developed against DDB_G0289645 can be tested on human enzymes to identify broadly effective compounds. Disease-associated mutations in human PEMT can be recreated in DDB_G0289645 to study their functional consequences in a simplified cellular context. Additionally, the ability to rapidly grow Dictyostelium to high cell densities facilitates biochemical purification of methyltransferase complexes for structural studies. This multi-faceted approach using Dictyostelium as a model system can accelerate understanding of human phospholipid methyltransferases involved in liver disease, metabolic disorders, and neurological conditions where phospholipid metabolism is implicated.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.