Recombinant Dictyostelium discoideum Peroxisomal membrane protein PEX14 (pex14)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
pex14; DDB_G0293264; Peroxisomal membrane protein PEX14; PTS1 receptor-docking protein; Peroxin-14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-748
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
pex14
Target Protein Sequence
MDNDDINNNNNNNNNNNNNNNSQELDQQEQTQEEITKQRIQKRKEEAKRIMEERKKREQQ PPSQRQYEDVEDDQQQQPIRPIKQLPQRQQQYDDNDEPPQQQQYEPKISQRKVPLPPMKQ PTTSSTASAATGSILSPSSNFREDMVKKAVLFLNNPNVKNTALARKVAYLEKKGLTSDEV KEALKRVETGNINGSSTNNSNITQSNSISRTRNDNYGNNNNNSSNNNNNIQQQQYYQQQQ QQHQQQQQMALTQIQSYQKRLEADDQRIAQLMMNNNRFSWNSFLFSVTAIVGAASGLAYL TSNYIIPFLNGGKTNKDASANMDKKITSLQEEIIKLQSTIIQQGNDFRESTKSLKTLIEQ QQQQILQQQQINSVSTTTNSATSASNSSEIVEIKKELKNLINLIGNKENSNNSNNNSNNS NNNNGYSKYNGFNGVYNKSSYDDVSTNNNNKTNSPPSPNKPTTTTTTTATSTPGSNISNT NKTLPPIIKTNPYSHLSWKLPTDQPPVIPSWQQKSSNPPSDLSNANDKSSPSNSNPSTPT KPYQSSFNYGDVNSFVGGSNTLNFDEKPTTTTTTSTTPSNERPSSPSVNNNNNNNNNNNN NNNNNNNNNNNTTIASTSNESNNSKVETTSNDSDKSTSPSSSSNNTTSTTATTTTITSAS TEDNKQQSDETPYSSDFLDVINQLKQGKTPPGIRTDIDDKPLENSTVTKSAKERPKKPWE RDTLTSVTNNLSVEETQTINNTDSSVEK
Uniprot No.

Target Background

Function
Potentially involved in peroxisomal translocation.
Database Links
Protein Families
Peroxin-14 family
Subcellular Location
Peroxisome membrane; Single-pass membrane protein.

Q&A

What is the topology and membrane orientation of PEX14 in Dictyostelium discoideum?

PEX14 is an integral peroxisomal membrane protein that serves as a central component of the docking complex for matrix protein import. Unlike the conventional single-pass membrane proteins, PEX14 exhibits a unique dual topology in the peroxisomal membrane. Current evidence suggests that approximately half of PEX14 molecules orient with their N-terminus facing the peroxisomal lumen (Nin-Cout topology), while the other half adopt the opposite orientation .

This dual topology can be verified experimentally through PEGmal accessibility assays, which show that cysteines introduced on either side of the transmembrane segment are accessible to modification in approximately 50% of the protein population . In contrast, conventional peroxisomal membrane proteins like PEX17 consistently show their N-termini facing the lumen and C-termini in the cytosol .

How does PEX14's domain structure contribute to its function in peroxisomal import?

PEX14 contains several distinct functional domains:

DomainPositionFunctionBinding Partners
N-terminal domain (NTD)N-terminusReceptor bindingPEX5, tubulin
Transmembrane segmentCentral regionMembrane anchoring-
Coiled-coil domainAfter transmembrane regionOligomerizationPEX14, PEX17
C-terminal region (CTR)C-terminusUnknown, possibly cargo releasePEX5 C-terminus

The N-terminal domain forms a three-helical bundle that binds to WxxxF motifs in the PEX5 receptor . The coiled-coil domain mediates the formation of a heterotetrameric complex with PEX17 in some organisms, creating a rod-like structure approximately 20 nm in length . Recent evidence suggests that the intrinsically disordered C-terminal domain of PEX14 may be involved in an additional interaction with the C-terminus of PEX5, which appears critical for efficient protein import .

What expression systems are effective for producing recombinant D. discoideum PEX14?

While specific data for D. discoideum PEX14 expression is limited, related research provides methodological guidance:

  • Bacterial expression systems: Recombinant PEX14 can be produced in Escherichia coli BL21 Rosetta cells using appropriate expression vectors such as pET42b . This approach is suitable for structural and biochemical studies.

  • Eukaryotic expression: For functional studies, mammalian expression systems using HEK293 cells have been effectively used to express PEX14 variants for complementation studies in PEX14-deficient cell lines .

For D. discoideum-specific expression, consider:

  • Using D. discoideum's own promoter sequences for homologous expression

  • Optimizing codon usage for heterologous expression systems

  • Including appropriate tags (His, GST, or FLAG) for purification and detection

  • Expressing shorter, functional domains separately if full-length protein proves insoluble

How can researchers verify the functionality of recombinant PEX14?

Functional validation of recombinant PEX14 can be achieved through multiple complementary approaches:

  • Complementation assays: Express the recombinant PEX14 in PEX14-deficient cells and assess restoration of peroxisomal matrix protein import using fluorescent markers like GFP-SKL .

  • Binding assays: Test interaction with known binding partners (PEX5, PEX13, tubulin) using techniques such as:

    • ELISA-based binding assays (KD for PEX14-NTD/PEX5 interaction: ~0.5-1.3 nM)

    • Isothermal titration calorimetry (ITC)

    • Surface plasmon resonance (SPR)

  • Subcellular localization: Confirm proper targeting to peroxisomes using fluorescence microscopy with appropriate peroxisomal markers .

What methods can reveal the novel PEX14-PEX5 interaction interfaces?

Recent research has identified a previously unknown interaction between the C-terminal regions of PEX14 and PEX5, distinct from the well-characterized N-terminal domain interaction . To investigate such interfaces:

  • Site-directed mutagenesis: Generate alanine substitution mutants of potential interface residues and assess their impact on binding and function. For example, a PEX14 variant with six alanine substitutions in the C-terminal region (PEX14(6A)) showed significant impairment in complementation assays .

  • Structural characterization: The C-terminal region beyond the coiled-coil domain (CTRcc) appears intrinsically disordered, making crystallization challenging. Alternative approaches include:

    • Nuclear magnetic resonance (NMR) spectroscopy

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS)

    • Cross-linking mass spectrometry (XL-MS)

  • Functional validation: Assess the impact of mutations on peroxisomal protein import using fluorescent reporter proteins (e.g., eGFP-SKL) in cellular models .

How does PEX14's interaction with the cytoskeleton affect peroxisome dynamics?

PEX14 has been shown to bind directly to microtubules with high affinity (KD ~2.1 nM), suggesting a role in linking peroxisome positioning and movement to protein import . Research approaches include:

  • In vitro binding assays: Quantify the interaction between PEX14 and tubulin using ELISA-based methods. Mutations in key residues (F52A, K56A) significantly reduce binding affinity, with the F52A/K56A double mutant showing a KD of 89 ± 17 nM compared to 2.1 ± 0.2 nM for wild-type .

  • Competition studies: Investigate how PEX5 binding affects PEX14-microtubule interaction. Preincubating PEX14 with PEX5 significantly blocks its binding to microtubules, suggesting competitive binding to the same or overlapping sites .

  • Live-cell imaging: Monitor peroxisome motility in cells expressing wild-type versus mutant PEX14 or under conditions of PEX5 overexpression .

How can D. discoideum be used as a model system for studying PEX14-related disorders?

D. discoideum offers several advantages as a model for studying peroxisomal disorders:

  • Conservation of peroxisomal machinery: D. discoideum possesses homologs of human peroxisomal biogenesis factors, including PEX14 .

  • Experimental tractability: The organism is amenable to genetic manipulation through techniques such as CRISPR-Cas9, allowing for the generation of knockout and knockin models .

  • Relevance to human disease: D. discoideum has been successfully used as a model for studying other lysosomal storage disorders, such as mucolipidosis type IV .

Research approaches specific to PEX14 could include:

  • Creating PEX14-null D. discoideum strains and characterizing effects on peroxisome biogenesis

  • Introducing human disease-associated PEX14 mutations to study their functional impacts

  • Screening for genetic modifiers that affect PEX14 function in this model system

What are the consequences of PEX14 mislocalization or overexpression?

Research indicates that PEX14 mislocalization can have significant cellular consequences:

  • Mitochondrial impact: In PEX3-knockout cell lines where peroxisomes are absent, PEX14 mislocalizes to mitochondria. Interestingly, even in wild-type cells, overexpression of PEX14 results in its mitochondrial localization, leading to mitochondrial abnormalities .

  • Expression level-dependent localization: PEX14 localization depends on its expression levels, with proper peroxisomal targeting at low-level expression and mitochondrial mislocalization at higher levels .

These findings suggest that tight regulation of PEX14 expression is critical for proper peroxisomal and mitochondrial function, and they highlight potential mechanisms by which peroxisomal disorders might impact mitochondrial health.

How does PEX14 contribute to the formation of the peroxisomal import pore?

PEX14 is a key component of the translocation machinery for peroxisomal matrix proteins:

  • Pore formation: For PTS1 protein import in Saccharomyces cerevisiae, PEX5 integrates into the peroxisomal membrane to form a transient translocation pore alongside PEX14 . For PTS2 import, the pore is formed by PEX14, PEX17, and PEX18 .

  • Nuclear pore-like mechanism: Recent research suggests PEX14 may function similarly to nucleoporins, with its YG domains forming a meshwork that restricts entry of large molecules into peroxisomes. This meshwork can be locally disrupted by transport receptors, allowing selective passage of cargo-bound receptors .

  • Structural features: Unlike conventional channel proteins, PEX14 lacks obvious features that could form an aqueous conduit, suggesting a unique mechanism for protein translocation .

What experimental approaches can determine if D. discoideum PEX14 forms a nuclear pore-like phase?

To investigate whether D. discoideum PEX14 forms a selective phase similar to nuclear pores:

  • Cysteine cross-linking: Introduce individual cysteines at specific positions in the YG domain and assess formation of disulfide-linked dimers using oxidizing agents (>70% efficiency has been observed in yeast PEX14) .

  • Permeability barrier assessment: Use PEGylated maleimide reagents of different sizes to test selective accessibility to introduced cysteines, which would indicate the presence of a size-selective barrier .

  • Domain swapping experiments: Replace the YG domains of PEX14 with FG domains from nucleoporins to test functional equivalence.

  • Super-resolution microscopy: Techniques like STED microscopy can visualize the spatial organization of PEX14 within the peroxisomal membrane at nanoscale resolution .

What are effective strategies for creating PEX14 knockout or knockdown models in D. discoideum?

Several approaches have proven successful for genetic manipulation in D. discoideum:

  • CRISPR-Cas9 genome editing: This technique has been successfully used to generate gene knockouts in D. discoideum and could be applied to create PEX14-null strains .

  • RNA interference (RNAi): For conditional knockdown, RNAi approaches can be used to reduce PEX14 expression levels without completely eliminating the protein.

  • Homologous recombination: Traditional gene replacement strategies using homologous recombination remain effective in D. discoideum.

When creating knockout models, it's important to verify the absence of peroxisomal protein import using markers such as GFP-SKL and to assess effects on both peroxisomal and mitochondrial morphology and function.

How can researchers perform structure-function analysis of PEX14 in D. discoideum?

To dissect the relationship between PEX14 structure and function:

  • Domain deletion constructs: Generate truncated versions of PEX14 lacking specific domains (N-terminal domain, transmembrane segment, coiled-coil domain, C-terminal region) and assess their ability to complement PEX14 deficiency.

  • Site-directed mutagenesis: Introduce point mutations at key residues:

    • Residues involved in PEX5 binding (e.g., F52)

    • Residues involved in microtubule binding (e.g., K56)

    • Residues in the novel C-terminal binding interface with PEX5

  • Fusion proteins: Create chimeric proteins by swapping domains between PEX14 from different species to identify species-specific functional differences.

  • Complementation analysis: Express mutant constructs in PEX14-deficient cells and quantify restoration of peroxisomal protein import using fluorescent reporter proteins.

How conserved is PEX14 structure and function across evolutionary diverse organisms?

Comparative analysis reveals both conservation and divergence in PEX14:

  • Core function conservation: PEX14's role in peroxisomal protein import appears to be conserved across eukaryotes, from protists to humans .

  • Structural diversity: While the N-terminal domain structure is well-conserved, other regions show more variation. For example:

    • Yeast PEX14 forms a 3:1 heterotetrameric complex with PEX17

    • Some organisms lack PEX17 entirely

    • The length and composition of the intrinsically disordered regions vary between species

  • Dispensability: Interestingly, PEX14 may be dispensable for import in some organisms, whereas PEX13 is essential for import in all organisms tested .

To study evolutionary aspects, approaches include phylogenetic analysis of PEX14 sequences, complementation studies with PEX14 from different species, and comparative structural analysis.

How does D. discoideum PEX14 compare with PEX14 from other model organisms?

A comparative analysis reveals:

OrganismPEX14 SizeNotable FeaturesModel Applications
D. discoideumNot specified in search resultsUsed as model for peroxisomal function studiesSocial amoeba model, developmental biology
Human41 kDa (calculated), 57 kDa (observed) Nin-Cout topology; binds microtubulesDisease-relevance, mammalian cell biology
S. cerevisiaeNot specifiedForms complex with PEX17; PEX14-PEX17 complex forms 20 nm rod-like structureGenetic tractability, simple eukaryote model
M. balamuthiNot specifiedSuccessfully targets peroxisomes when expressed in yeastStudies of anaerobic peroxisomes

D. discoideum offers unique advantages as a model organism, including its ability to transition between unicellular and multicellular states , making it valuable for studying the regulation of peroxisomal functions during development.

Research into D. discoideum PEX14 could provide insights into how peroxisomal protein import mechanisms have evolved and adapted to different cellular environments and metabolic requirements.

What imaging approaches are most effective for studying PEX14 localization and dynamics?

Several advanced imaging techniques are particularly suitable for PEX14 research:

  • Super-resolution microscopy: Techniques such as Structured Illumination Microscopy (SIM) provide enhanced resolution for visualizing PEX14 distribution within peroxisomal membranes .

  • Correlative light and electron microscopy (CLEM): This approach allows precise localization of fluorescently-tagged PEX14 within the ultrastructural context, as demonstrated in studies of PEX14-GFP in S. cerevisiae .

  • Electron tomography: For detailed 3D reconstruction of peroxisomal structures containing PEX14 .

  • Live-cell imaging: For tracking peroxisome dynamics and how they are affected by PEX14 manipulation or interaction with microtubules .

  • Förster resonance energy transfer (FRET): To study dynamic interactions between PEX14 and binding partners such as PEX5 or tubulin in living cells.

For quantification, automated image analysis can determine peroxisome number (e.g., 60 ± 20 peroxisomes per 100 μm² in M. balamuthi ) and distribution patterns.

What biochemical approaches best characterize PEX14 interactions with binding partners?

Multiple complementary biochemical techniques can characterize PEX14 interactions:

  • In vitro binding assays: ELISA-based methods have successfully determined binding affinities between PEX14 and partners:

    • PEX14-NTD binds to PEX5 with KD values of ~0.5-1.3 nM

    • PEX14-NTD binds to microtubules with KD of ~2.1 nM

  • Isothermal titration calorimetry (ITC): Provides thermodynamic parameters of binding, as demonstrated for the interaction between PEX14-NTD and the C-terminal region of β-tubulin .

  • Proximity-based labeling: BioID or APEX2 fusion proteins can identify proteins in close proximity to PEX14 in living cells.

  • Cross-linking coupled with mass spectrometry: Identifies interaction interfaces between PEX14 and binding partners.

  • Split-protein complementation assays: For validating protein-protein interactions in cellular contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.