Recombinant Dictyostelium discoideum Peroxisome biogenesis factor 3 (pex3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
pex3; DDB_G0281213; Peroxisome biogenesis factor 3; Peroxin-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-405
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
pex3
Target Protein Sequence
MENFQFEDLSPNKVSKVYQDLKKFGSFLYNHKMGVFLVSFSSGVAYLYHNITQSHKRKQI KLAKERVMTYFESTQKLSEREVDAIITKFIDENKILDKIQTPSLASIRSEKDPSEKLKLT DQLKVSIITKLFSVLYIIPMVTIFNRLQINLIGKYCYLDYVLYKDQEQHSMRLINQQTES NFINSRNNCYFFKDINFSQFINLIQEQIKISLKDWKIDQQSSFEGFLKLLINIRNNFEKK EIIASISSDNSLLKYLIPTEEEIDNLVQSQKTPENDNDIEYQNLKMLYNEIRNIFESQKF YDVLKDSINQSFLEFTKNLREDFESTELKKQIDSIVLPDLPIEMEIPKPLVTMHNIILLP KINKQIGNIIVNKKSIIEKIGSTDLINQLNYSVLTNDLDFNKVQF
Uniprot No.

Target Background

Function

Involved in peroxisome biosynthesis.

Database Links
Protein Families
Peroxin-3 family
Subcellular Location
Peroxisome membrane; Multi-pass membrane protein.

Q&A

How does PEX3 contribute to the unusual compartmentalization of sterol biosynthesis in D. discoideum?

D. discoideum exhibits a unique arrangement where multiple sterol biosynthesis enzymes (squalene synthase, squalene epoxidase, oxidosqualene cyclase, and cycloartenol-C-24-methyltransferase) are localized to peroxisomes, contrary to their typical endoplasmic reticulum localization in other organisms . PEX3, as a critical peroxisomal biogenesis factor, establishes the peroxisomal membrane structure necessary for these enzymes to function correctly.

Research has demonstrated that these peroxisomal sterol biosynthesis enzymes are tightly associated with the peroxisomal membrane, with varying dependencies on their PTS1 (Peroxisomal Targeting Signal Type 1) sequences:

EnzymeMembrane AssociationPTS1 Dependency
Squalene synthaseTight bindingLargely peroxisomal even without PTS1
Squalene epoxidaseAssociatedNot specified in data
Oxidosqualene cyclaseAssociatedEssential for peroxisomal localization
Cycloartenol-C-24-methyltransferaseTight bindingEssential for peroxisomal localization

This unique compartmentalization suggests that PEX3 plays a critical role in establishing a specialized peroxisomal environment for sterol biosynthesis in D. discoideum .

What expression systems are optimal for producing functional recombinant D. discoideum PEX3?

Based on available research data, several expression systems can be employed for D. discoideum PEX3:

  • Homologous Expression in D. discoideum: The most physiologically relevant approach utilizes D. discoideum-specific expression vectors derived from pDXA-3H (6.1 kb). These vectors contain the strong constitutive actin-15 promoter, appropriate polyadenylation signals, and can be designed to incorporate various tags for visualization or purification .

  • Mammalian Cell Expression: This system provides proper post-translational modifications and has been successfully used for expressing PEX3 from other species . For D. discoideum PEX3, mammalian cells can yield protein with >80% purity.

  • E. coli Expression System: While potentially challenging for membrane proteins, bacterial expression can be optimized using solubility-enhancing tags and controlled induction conditions.

The choice depends on research objectives:

  • For localization studies: Homologous expression in D. discoideum with fluorescent protein tags

  • For structural studies: Mammalian cell expression with purification tags

  • For interaction analyses: Expression system that preserves native conformation and post-translational modifications

What strategies effectively visualize PEX3 localization and dynamics in D. discoideum?

Fluorescent protein fusions have proven highly effective for visualizing PEX3 in D. discoideum:

  • Vector Selection: Specialized vectors for D. discoideum enable creation of N- or C-terminal fusions with CFP, YFP, or GFP variants . These vectors contain:

    • Strong constitutive actin-15 promoter

    • Multiple cloning sites

    • Appropriate Dictyostelium polyadenylation signals

    • Selection markers (typically G418 resistance)

  • Fusion Protein Design Considerations:

    • C-terminal tagging must account for potential disruption of PTS1 signals

    • N-terminal tagging should preserve membrane-targeting sequences

    • Internal GFP fusion may be necessary for proteins where both termini are functionally important

  • Live Cell Imaging Applications:

    • Time-lapse microscopy to track peroxisome biogenesis

    • Co-localization studies with ER markers to examine ER-to-peroxisome trafficking

    • FRAP (Fluorescence Recovery After Photobleaching) to analyze membrane dynamics

Research has demonstrated that Pex3p-GFP localization can reveal critical insights into peroxisome formation, particularly when examining mutants affecting the early secretory pathway .

How can researchers effectively study PEX3's interactions with the ER during peroxisome biogenesis?

Studies in yeast have established that PEX3 functions at the interface between the ER and developing peroxisomes, suggesting similar mechanisms may exist in D. discoideum . Methodological approaches include:

  • Conditional Expression Systems:

    • Utilizing regulated promoters (e.g., Tet-controlled or GAL1) to induce PEX3 expression and track nascent peroxisome formation

    • This approach revealed that suppression of ER-associated proteins (Sec20p, Sec39p, Dsl1p) affected Pex3p-GFP localization in yeast

  • Subcellular Fractionation:

    • Density gradient centrifugation to isolate peroxisomal, ER, and intermediate fractions

    • Western blotting of fractions to detect PEX3 distribution

    • Mass spectrometry to identify PEX3-associated proteins in different fractions

  • Dual Fluorescence Tagging:

    • Co-expression of fluorescently tagged PEX3 with ER markers

    • Time-lapse imaging to capture transitional states during peroxisome formation

    • Analysis of tubular-vesicular intermediates, which may represent ER-derived pre-peroxisomal structures

  • Biochemical Interaction Studies:

    • Co-immunoprecipitation with ER-associated secretory proteins

    • Proximity labeling techniques (BioID, APEX) to identify proteins in close proximity to PEX3

    • Crosslinking mass spectrometry to capture transient interactions

What approaches can elucidate the membrane topology and integration of PEX3 in D. discoideum peroxisomes?

Understanding PEX3's membrane association is critical given the tight membrane binding observed for several peroxisomal enzymes in D. discoideum . Effective approaches include:

  • Membrane Extraction Analysis:

    • Sequential extraction with increasing detergent concentrations or high-salt buffers

    • Carbonate extraction (pH 11.5) to distinguish peripheral from integral membrane proteins

    • Assessment of protein distribution between soluble and membrane fractions

  • Protease Protection Assays:

    • Treatment of isolated peroxisomes with proteases under various conditions

    • Analysis of protected fragments to determine membrane-embedded regions

    • Comparison with known topology models from other organisms

  • Domain Mapping:

    • Creation of truncated PEX3 variants tagged with fluorescent proteins

    • Analysis of localization and membrane association of these variants

    • Identification of minimal regions required for proper targeting and membrane integration

This methodological approach revealed that sterol biosynthesis enzymes in D. discoideum peroxisomes exhibit strong membrane association despite possessing putative PTS1 signals that would typically direct them to the peroxisomal matrix .

How does PEX3 function in coordinating the compartmentalization of the mevalonate pathway in D. discoideum?

Research has revealed that D. discoideum exhibits a partial peroxisomal localization of the mevalonate pathway, with three enzymes (3-hydroxy-3-methylglutaryl-coenzyme A synthase isozyme B, phosphomevalonate kinase, and farnesyl diphosphate synthase) localized to peroxisomes . PEX3's role in establishing this compartmentalization can be investigated through:

  • Enzyme Distribution Analysis:

    EnzymeCellular LocalizationPTS SignalMembrane Association
    HMG-CoA synthase isozyme BPeroxisomalPresentNot specified
    Phosphomevalonate kinasePeroxisomalPTS1 (-PKL)Not specified
    Farnesyl diphosphate synthasePeroxisomalPresentNot specified
    HMG-CoA reductaseEndoplasmic reticulumAbsentMembrane-associated
    HMG-CoA synthase isozyme ACytosolicAbsentNot specified
    Mevalonate kinaseCytosolicAbsentNot specified
    Diphosphomevalonate decarboxylaseCytosolicAbsentNot specified
    IDP-isomeraseCytosolicAbsentNot specified
  • Metabolic Flux Analysis:

    • Isotope labeling studies to track metabolite movement between compartments

    • Analysis of rate-limiting steps in the pathway when peroxisomal import is compromised

    • Comparison of pathway efficiency in wild-type versus PEX3-deficient cells

  • Interaction Studies:

    • Investigation of physical interactions between PEX3 and peroxisomal mevalonate pathway enzymes

    • Analysis of whether PEX3 facilitates enzyme clustering or organization within peroxisomes

    • Examination of potential metabolic channeling mechanisms

The unique compartmentalization of these metabolic pathways in D. discoideum makes it an excellent model for studying the fundamental principles of organelle-based metabolic regulation .

What methodological approaches can determine if PEX3 influences the membrane association of peroxisomal sterol biosynthesis enzymes?

Research has shown that multiple sterol biosynthesis enzymes are tightly associated with the peroxisomal membrane in D. discoideum, despite possessing PTS1 signals that would typically direct them to the peroxisomal matrix . To investigate PEX3's potential role in this phenomenon:

  • PEX3 Depletion Studies:

    • Creation of conditional PEX3 knockdown/knockout systems

    • Analysis of enzyme localization and membrane association in PEX3-deficient cells

    • Rescue experiments with wild-type or mutant PEX3 variants

  • Protein-Protein Interaction Analysis:

    • Co-immunoprecipitation of PEX3 with sterol biosynthesis enzymes

    • Yeast two-hybrid or split-ubiquitin assays to detect direct interactions

    • FRET/FLIM analysis of potential interactions in intact cells

  • Domain Mapping:

    • Identification of regions in sterol biosynthesis enzymes responsible for membrane association

    • Creation of chimeric proteins to test if these regions interact with PEX3

    • Analysis of whether PEX3 influences the membrane association of reporter proteins fused to these domains

This approach could reveal whether PEX3 plays a direct role in organizing these enzymes at the peroxisomal membrane or simply establishes the peroxisomal compartment where other factors mediate enzyme organization .

What quality control parameters are critical for recombinant D. discoideum PEX3 experiments?

When working with recombinant D. discoideum PEX3, researchers should monitor:

  • Purity Assessment:

    • SDS-PAGE analysis (target >80% purity for most applications)

    • Western blotting to confirm identity and integrity

    • Mass spectrometry to verify sequence and potential modifications

  • Functional Validation:

    • Ability to complement PEX3-deficient cells

    • Correct subcellular localization when expressed with appropriate tags

    • Interaction with known binding partners

  • Storage and Stability:

    • Optimal storage in PBS buffer with 50% glycerol at -20°C or -80°C

    • Avoidance of repeated freeze-thaw cycles

    • Preparation of working aliquots stored at 4°C for up to one week

  • Endotoxin Testing:

    • LAL method to ensure preparations have <1.0 EU per μg protein

    • Critical for experiments involving cell culture systems

What control experiments are essential when studying PEX3 function in D. discoideum?

Robust control experiments are critical for PEX3 research:

  • Localization Studies:

    • Inclusion of known peroxisomal markers (matrix and membrane proteins)

    • ER markers to distinguish peroxisomal from ER localization

    • Empty vector controls expressing the tag alone

    • PTS1-deleted variants to assess targeting mechanisms

  • Functional Complementation:

    • Wild-type PEX3 positive control

    • Known non-functional PEX3 mutations as negative controls

    • Partial function variants to establish structure-function relationships

  • Protein Interaction Studies:

    • Non-specific binding controls (unrelated proteins)

    • Competition assays with unlabeled proteins

    • Truncation or mutation analysis to map interaction domains

  • Membrane Association Analysis:

    • Comparison with known integral membrane proteins

    • Comparison with known peripheral membrane proteins

    • Inclusion of soluble proteins as negative controls

These controls help establish the specificity and physiological relevance of observed effects, particularly important given PEX3's central role in peroxisome biogenesis and the unusual peroxisomal localization of sterol biosynthesis in D. discoideum .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.