Recombinant Dictyostelium discoideum Phosphatidylinositide phosphatase SAC1 (sac1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, we can prioritize the development of a specified tag if provided in advance.
Synonyms
sac1; DDB_G0271630; Phosphatidylinositol-3-phosphatase SAC1; Phosphatidylinositol-4-phosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-581
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
sac1
Target Protein Sequence
MNIELINTNERFILINNGNKDKSLNIDKHSVKASISVGVPKNNEKVLTRIENVKGIIGCI QLVSGHYLMIFKEHNHVATVTGKKIYQMKDVELIPFFPNQQSLVSIPDQDAEEQHLSMIR WLLSSENFYFSYDYDFTLTLQRQYSTTTTTTSGSSLGERCDSRFFWNEKYVTILSKEHGL GDWILPITMGFVESKTLGGTCQFTLISRRNLNRSGTRYNVRGIDKKGNVANNVETEQIIE IKENTFTSFVQVRGSIPLLWSQFPTLKYKPSVKFYGDEKENSQALEQHFKQLHQLYGSTT VVNLIDRKGAELKLGEAYEERVKSLKDVHYVWFDFHSICKGMRYDKLSILMDQLKDDLKQ YGFFFVEDGKIVQKQQGVFRTNCIDNLDRTNVVQSLITRHSLENQMASVLNKQIPSTTFK GDQFEYVFKNIWADHGDAISTQYSGTGALKNDFTRTGKRNFQGVLRDGENSVKRYYLNNF KDGFRQDSYFLFTNPSVDLTTAKQHESKPPSPLIWIFSFVFAAIFLANLYLPSATSSIGG FISQTTVLVGSVFFALKLAMKYQASIVDKPTLFKLDSIYKN
Uniprot No.

Target Background

Function
Phosphatidylinositide phosphatase catalyzing the hydrolysis of phosphatidylinositol 3-phosphate (PtdIns(3)P) and phosphatidylinositol 4-phosphate (PtdIns(4)P). Exhibits low activity towards phosphatidylinositol-3,5-bisphosphate (PtdIns(3,5)P2).
Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the role of Sac1 in Dictyostelium discoideum?

Sac1 is a phosphatidylinositide phosphatase that plays a crucial role in sphingolipid metabolism in D. discoideum. Research has shown that D. discoideum contains two structural homologues of Sac1 (Sac1 and Sac1-like) . Sac1 functions as part of the SPOTS complex (Serine Palmitoyltransferase, Orm, Tsc3, and Sac1), which regulates sphingolipid biosynthesis. A recent cryo-EM study revealed the structure of the ceramide-bound SPOTS complex in yeast and provided evidence for the presence of a Sac1-containing SPOTS complex in D. discoideum . This suggests a conserved role for Sac1 in regulating sphingolipid homeostasis across evolutionary boundaries.

How does D. discoideum Sac1 compare structurally to homologues in other organisms?

AlphaFold modeling of D. discoideum Sac1 compared with experimental structures reveals that unlike its yeast counterpart, D. discoideum Sac1 lacks the C-terminal hairpin β-sheet motif . Despite this structural difference, there appears to be a conserved basis for Lcb2-binding independent of the Sac1 β-sheet motif . Multiple sequence alignment shows poor conservation of key residues across species, suggesting potential functional divergence while maintaining core enzymatic activities . This structural analysis provides insights into how Sac1 function may be conserved across evolutionarily distant organisms despite sequence variations.

What are the optimal methods for expressing and purifying recombinant D. discoideum Sac1?

Based on established protocols for similar proteins, the following methodological approach is recommended:

Expression and Purification Protocol:

StepProcedureDetails
1Gene CloningClone the full-length D. discoideum Sac1 gene into an expression vector with an N-terminal His-tag
2Expression SystemTransform into E. coli BL21(DE3) or similar strain
3Culture ConditionsGrow at 37°C until OD600 of 0.6-0.8, then induce with 0.5mM IPTG at 18°C overnight
4Cell LysisSonication or French press in buffer containing 50mM Tris-HCl pH 8.0, 300mM NaCl, 10% glycerol, and protease inhibitors
5PurificationNi-NTA affinity chromatography followed by size exclusion chromatography
6StorageStore in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

For membrane-associated proteins like Sac1, including detergents (0.1% DDM or 1% CHAPS) during purification may improve yield and stability. Commercial recombinant proteins are typically lyophilized and can be reconstituted to 0.1-1.0 mg/mL in deionized sterile water with 5-50% glycerol for long-term storage at -20°C/-80°C .

How can genetic manipulation techniques be optimized for studying Sac1 function in D. discoideum?

Recent advances in D. discoideum genetic engineering have simplified the manipulation of both axenic and non-axenic strains:

Transfection Protocol for D. discoideum:

  • Harvest cells grown on bacterial suspensions in SorMC buffer (5×10^6-1×10^7 cells per transfection)

  • Wash cells once in SorMC and resuspend in 400μl SorMC

  • Add DNA (1μg for extrachromosomal plasmids or 10μg for knock-outs/knock-ins)

  • Electroporate twice at 500V and 25μF with a 2-second gap (time constant 0.7-0.8 seconds)

  • Immediately dilute into bacterial suspension (OD600 = 2 in SorMC)

  • After 5 hours recovery, add selection (10μg/ml G418 or 100μg/ml hygromycin)

This protocol works efficiently for wild-type strains which grow faster on bacteria than axenic strains in liquid media (doubling time of ~4 hours versus ~8 hours) . For Sac1 studies, consider using vectors from the pDM series that allow exchange of selectable markers and expression of fluorescent reporters .

How does Sac1 contribute to the sphingolipid biosynthetic pathway in D. discoideum?

D. discoideum possesses a distinct sphingolipid profile characterized by the production of phosphoinositol-containing sphingolipids with predominantly phytoceramide backbones . The sphingolipid biosynthetic pathway in D. discoideum has been reconstructed through bioinformatics and functional analyses:

Key Enzymes in D. discoideum Sphingolipid Biosynthesis:

EnzymeFunctionD. discoideum Homologue(s)
Serine Palmitoyltransferase (SPT)Catalyzes formation of 3-KDSPart of SPOTS complex with Sac1
3-keto-sphinganine reductaseReduces 3-KDS to sphinganineKsrA-1 and KsrA-2 (identical copies)
Ceramide synthaseConverts sphinganines to dihydroceramidesCrsA (single homologue)
Sphingolipid hydroxylasesModify sphingolipid backbonesLhsA, LhsB, LhsC, LhsD
Dihydroceramide desaturaseCreates unsaturated ceramidesDesA
IPC synthaseTransfers phosphoinositol to ceramideDdIPCS1

Sac1 functions within the SPOTS complex to regulate the initial step of sphingolipid biosynthesis . This complex appears to interact with ceramide, suggesting a feedback mechanism where end products regulate the pathway's initial steps . Understanding Sac1's role in this process provides insights into how cells maintain sphingolipid homeostasis.

What experimental approaches are most effective for studying the impact of Sac1 on cell migration in D. discoideum?

D. discoideum is an established model for studying cell migration, with advanced methodologies available for quantitative analysis:

Experimental Design for Cell Migration Studies:

When studying Sac1's impact on migration, compare wild-type, Sac1 knockout, and rescue strains under identical conditions, analyzing both individual cell trajectories and population-level statistics.

How can Sac1 function be assessed in the context of phagocytosis and host-pathogen interactions?

As a professional phagocyte, D. discoideum is an excellent model for studying phagocytosis and host-pathogen interactions. To assess Sac1's role in these processes:

Phagocytosis Assay Protocol:

  • Grow D. discoideum cells (wild-type, Sac1 mutants, and rescue strains) to mid-log phase

  • Expose cells to fluorescently labeled bacteria (e.g., E. coli expressing DsRed or K. pneumoniae expressing GFP)

  • Quantify bacterial uptake using flow cytometry or microscopy at defined time points

  • Analyze phagocytic rate, cup formation, and phagosome maturation

Multicellular Phase Infection Model:

  • Allow D. discoideum to form migrating slugs (~18 hours in dark, moist chamber)

  • Injure slugs with a sterile needle and layer with bacterial suspension

  • Image infected slugs at appropriate time points (8h for E. coli DsRed, 20-24h for K. pneumoniae GFP)

  • Compare bacterial clearance between wild-type and Sac1-manipulated strains

This approach allows assessment of Sac1's role in both single-cell phagocytosis and multicellular host defense mechanisms .

How should researchers analyze sphingolipid profiles when studying Sac1 function?

Mass spectrometry-based lipidomics is the preferred approach for analyzing sphingolipid profiles in D. discoideum:

Lipidomics Workflow for Sphingolipid Analysis:

StageProcedureConsiderations
Sample PreparationLipid extraction using chloroform/methanol/waterInclude internal standards for quantification
MS AnalysisCombine targeted and untargeted approachesUse both positive and negative ionization modes
Data ProcessingPeak identification and quantificationFilter based on mass accuracy and retention time
Statistical AnalysisCompare profiles across experimental conditionsApply appropriate normalization methods
ValidationConfirm key findings using orthogonal methodsConsider isotope labeling to track metabolic flux

When comparing wild-type and Sac1-mutant strains, focus on changes in inositol-phosphorylceramide (IPC) levels, as D. discoideum produces phosphoinositol-containing sphingolipids similar to plants and fungi . Changes in ceramide species composition (particularly phytoceramides) may also provide insights into Sac1's regulatory role.

What are the key considerations when interpreting contradictory results in Sac1 functional studies?

When facing contradictory results in Sac1 studies, consider the following factors:

Always validate key findings using multiple approaches and clearly report experimental conditions to facilitate reproduction and comparison of results.

What are promising research avenues for understanding Sac1's role in D. discoideum beyond sphingolipid metabolism?

Emerging research suggests Sac1 may have broader functions beyond sphingolipid regulation:

  • Membrane organization and trafficking: Investigate Sac1's dual localization to both the Golgi apparatus and contractile vacuole in D. discoideum , which suggests potential roles in membrane organization and water discharge.

  • Host-pathogen interactions: Given that D. discoideum was "exploited by pathogens well before the evolution of mammals" , studying Sac1's role during infection may reveal fundamental sphingolipid-dependent mechanisms underlying host-pathogen interactions.

  • Phosphoinositide signaling network: Examine interactions between Sac1 and other phosphoinositide-modifying enzymes like PIPkinA, which inhibits Ras activation and functions in chemorepulsion .

  • Developmental transitions: Explore whether Sac1 function changes during D. discoideum's remarkable life cycle transition from unicellular to multicellular forms, potentially contributing to the "superhero, shape-shifting qualities" of this organism .

  • Evolutionary conservation: Compare Sac1 function across evolutionary boundaries to understand fundamental mechanisms that may be conserved in mammalian systems.

How might advances in structural biology and computational modeling enhance our understanding of D. discoideum Sac1?

Recent technological advances offer new opportunities for Sac1 research:

  • Cryo-EM studies: Building on recent successes with the SPOTS complex , high-resolution structural determination of D. discoideum Sac1 alone and in complexes could reveal mechanism-specific details.

  • AlphaFold integration: Combining experimental structures with AlphaFold predictions can provide insights into regions difficult to resolve experimentally and predict effects of mutations.

  • Molecular dynamics simulations: These can reveal dynamic aspects of Sac1 function, including conformational changes associated with substrate binding and catalysis.

  • Integrative modeling: Combining multiple data sources (crosslinking mass spectrometry, SAXS, NMR) with computational approaches could generate comprehensive models of Sac1-containing complexes.

  • Machine learning approaches: These could predict functional regions and protein-protein interaction interfaces based on sequence and structural features, guiding experimental design.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.