Recombinant Dictyostelium discoideum PRA1 family protein 1 (prafA)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Dictyostelium discoideum PRA1 family protein 1 (PrafA) is a protein expressed in the slime mold Dictyostelium discoideum. PrafA belongs to the PRA1 (PReventing Apoptosis 1) family of proteins. Recombinant PrafA is produced in various expression systems, including yeast, E. coli, baculovirus, and mammalian cells .

Characteristics

CharacteristicDescription
NameRecombinant Dictyostelium discoideum PRA1 family protein 1 (prafA)
Source OrganismDictyostelium discoideum
Expression SystemsYeast, E. coli, Baculovirus, Mammalian cell
Related IdentifiersKEGG: ddi:DDB_G0278887 , STRING: 44689.DDB0304559
FunctionThe PRA1 family proteins are generally involved in various cellular processes, but specific functions may vary depending on the organism and context (further research is needed to define the precise function of prafA)

Production

Recombinant PrafA can be produced using different expression systems :

  • Yeast: Offers a eukaryotic expression system that can perform post-translational modifications.

  • E. coli: Provides a rapid and cost-effective method for protein production.

  • Baculovirus: Utilizes insect cells for protein expression, allowing for large-scale production.

  • Mammalian Cells: Allows for expression in a system that closely mimics the native eukaryotic environment, potentially ensuring proper folding and post-translational modifications.

Avi-Tag Biotinylated PrafA

A specific form of recombinant PrafA is produced in E. coli with an Avi-tag for biotinylation. The AviTag is a 15 amino acid peptide to which biotin is covalently attached by the E. coli biotin ligase (BirA) . This biotinylation can be useful for protein purification and immobilization in various biochemical assays.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its incorporation.
Synonyms
prafA; DDB_G0278887; PRA1 family protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-235
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
prafA
Target Protein Sequence
MESNSNSNETMYGNPNINMGFVDSGNSNIGNNTGSMSPPPQQQQQPQQASSTPAGSVGIG GLSFSLGANGISLEPSSISHRVNAITSKIKEFKQERMETTRDWRSFVGSRQQYGLPNIKD TTSRIKENVVYFQSNYLILFLCFSVFFIITNPFYLLLLGVLLFISVYLHNSTTLTDIQRK IAYGIQAFLSIYFLLYAGSSIFWLVGATCCITLLHASFHSPNSTDETNIKFGDGV
Uniprot No.

Target Background

Function
May function as a general Rab protein regulator.
Database Links
Protein Families
PRA1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How does Dictyostelium discoideum prafA differ from other PRA1 family proteins in different organisms?

While Dictyostelium discoideum PRA1 family protein 1 (prafA) shares homology with other PRA1 family members, it has distinct characteristics compared to well-studied examples like Candida albicans Pra1:

FeatureD. discoideum prafAC. albicans Pra1
Length235 amino acids299 amino acids
Primary functionNot fully characterizedImmune evasion
Surface bindingNot well documentedBinds complement inhibitors
SecretionNot well documentedBoth surface-bound and secreted
Known binding partnersLimited informationBinds C4BP, Factor H, FHL-1, plasminogen

Unlike C. albicans Pra1, which has been extensively studied for its role in fungal virulence and immune evasion, the specific functions of D. discoideum prafA remain less characterized. C. albicans Pra1 is known to bind human complement inhibitors and play multiple roles in immune evasion, including blocking complement activation and interfering with phagocyte recognition .

What are the optimal storage and reconstitution conditions for recombinant D. discoideum prafA?

For optimal stability and activity of recombinant D. discoideum prafA, adhere to the following protocol:

  • Storage conditions:

    • Store lyophilized protein at -20°C/-80°C upon receipt

    • After reconstitution, create working aliquots to avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

    • For long-term storage, add glycerol to 5-50% final concentration (50% is recommended) and store at -20°C/-80°C

  • Reconstitution protocol:

    • Briefly centrifuge the vial prior to opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Gently mix to ensure complete solubilization

    • For long-term storage, add glycerol as mentioned above

Repeated freeze-thaw cycles significantly reduce protein activity, so proper aliquoting is essential for maintaining experimental reproducibility.

How can researchers verify the purity and functionality of recombinant D. discoideum prafA for experimental use?

A multi-step verification process is recommended to ensure both purity and functionality:

  • Purity assessment:

    • SDS-PAGE analysis under both reducing and non-reducing conditions (>90% purity is standard)

    • Western blot using anti-His antibodies to confirm identity

    • Size exclusion chromatography to evaluate aggregation state

  • Functionality verification:

    • Binding assays with potential interaction partners (similar to methods used with C. albicans Pra1)

    • Circular dichroism to verify proper folding

    • If developing antibodies against the protein, ELISA to verify antigen recognition

For experiments requiring high confidence in protein quality, isothermal titration calorimetry (ITC) can be used to measure binding interactions, as demonstrated with C. albicans Pra1 and C4BP, which showed an affinity (Ka) of 1.90E5 ± 3.04E4 m−1 .

How can immunoprecipitation experiments be optimized when studying D. discoideum prafA interactions?

When designing immunoprecipitation (IP) experiments to study D. discoideum prafA interactions:

  • Pre-experiment considerations:

    • Choose between native IP (preserves physiological interactions) and denaturing IP (higher specificity)

    • Consider His-tag based purification as an alternative to antibody-based IP

    • Prepare appropriate controls (IgG control, lysate from cells not expressing the protein)

  • Optimization strategies:

    • Buffer composition: Start with DPBS as used in Pra1-C4BP interaction studies

    • For potentially weak interactions, use mild detergents and include protease inhibitors

    • Cross-linking may be necessary to capture transient interactions

    • Wash stringency must be balanced between reducing background and maintaining true interactions

  • Analysis of results:

    • Confirm success with Western blotting for both bait and prey proteins

    • Consider mass spectrometry for unbiased identification of binding partners

    • Validate novel interactions with reverse IP or other binding assays

Each step should be optimized individually, as the optimal conditions may vary depending on the specific interaction being studied.

What techniques are most effective for studying the subcellular localization of prafA in D. discoideum?

Multiple complementary approaches should be employed to accurately determine prafA subcellular localization:

  • Microscopy-based techniques:

    • Immunofluorescence using anti-prafA or anti-His antibodies

    • Fusion with fluorescent proteins (e.g., GFP, mCherry) at either N- or C-terminus

    • Co-localization studies with established organelle markers

    • Super-resolution microscopy for detailed localization analysis

  • Biochemical approaches:

    • Subcellular fractionation followed by Western blot analysis

    • Protease protection assays to determine membrane topology

    • Density gradient ultracentrifugation for membrane association studies

  • Controls and validation:

    • Confirm specificity of antibodies using prafA knockout strains

    • Use multiple organelle markers to avoid misinterpretation

    • Compare results from different techniques to ensure consistency

Learning from studies on related proteins, it's worth noting that the Dd-TRAP1 protein in D. discoideum shows density-dependent translocation from the cell cortex to mitochondria . This suggests that cellular localization of D. discoideum proteins can be dynamic and influenced by environmental factors.

How might researchers investigate potential immune evasion functions of D. discoideum prafA based on findings from other PRA1 family proteins?

Given the established role of C. albicans Pra1 in immune evasion, investigating similar functions in D. discoideum prafA requires a systematic approach:

  • Binding partner identification:

    • ELISA-based screening for binding to human complement regulators (C4BP, Factor H)

    • Surface plasmon resonance to determine binding kinetics

    • Pull-down assays from human serum followed by mass spectrometry

  • Functional assays:

    • Complement activation assays measuring C3b and C4b deposition

    • Cofactor activity assays for Factor I-mediated cleavage of C3b/C4b

    • Flow cytometry to quantify binding of complement regulators to wild-type vs. prafA knockout D. discoideum

  • Experimental design considerations:

    • Include both the membrane-bound and potentially secreted forms of prafA

    • Assess binding under different pH conditions (given "pH-regulated" nature of some PRA1 proteins)

    • Compare results with positive controls (e.g., C. albicans Pra1)

Research with C. albicans Pra1 demonstrated that it binds C4BP with an ionic interaction, with binding domains localized to complement control protein domains 4, 7, and 8 . Similar binding site mapping could be performed for D. discoideum prafA if comparable interactions are identified.

What are the key considerations when designing a knockout or knockdown experiment for D. discoideum prafA?

Creating and analyzing prafA-deficient D. discoideum requires careful planning:

  • Strategy selection:

    MethodAdvantagesDisadvantages
    CRISPR-Cas9 knockoutComplete protein eliminationPotential developmental defects if essential
    RNAi knockdownTunable reduction in expressionIncomplete silencing
    Inducible systemsTemporal controlTechnical complexity
  • Control development:

    • Generate revertant strains (knockout with restored gene)

    • Create point mutants affecting specific functions rather than whole-gene knockouts

    • Use multiple independent knockout/knockdown clones

  • Phenotypic analysis:

    • Growth curves under various conditions

    • Developmental phenotyping (D. discoideum has a complex life cycle)

    • Resistance to environmental stressors

    • Potential changes in protein-protein interactions

Drawing parallels from TRAP1-RNAi cells in D. discoideum, which showed defects in prestarvation response and reduced expression of differentiation-associated genes (dia1 and dia3) , knockout phenotypes can provide valuable insights into protein function even when the primary function is not immediately obvious.

How does sequence conservation between D. discoideum prafA and C. albicans Pra1 correlate with functional similarities?

Understanding the evolutionary relationship between these PRA1 family proteins can provide insights into functional conservation:

  • Sequence analysis approach:

    • Multiple sequence alignment of PRA1 family proteins from diverse organisms

    • Identification of conserved domains and motifs

    • Prediction of functional regions based on conservation patterns

    • Structural modeling to compare three-dimensional organization

  • Structure-function correlation:

    • Map known functional regions of C. albicans Pra1 (e.g., C4BP binding domains) to D. discoideum prafA

    • Design chimeric proteins to test function of specific domains

    • Use site-directed mutagenesis to test the importance of conserved residues

  • Functional comparison:

    • Test whether D. discoideum prafA can complement C. albicans Pra1 knockout phenotypes

    • Compare binding partners and binding affinities between the two proteins

    • Investigate whether both proteins show similar localization or secretion patterns

The collagen-like motif identified in C. albicans Pra1, potentially involved in extracellular matrix attachment , could be a starting point for identifying functional domains in D. discoideum prafA if present.

What experimental approaches can determine if D. discoideum prafA exhibits similar complement evasion mechanisms as observed in C. albicans Pra1?

To investigate potential complement evasion functions of D. discoideum prafA:

  • Direct binding assays:

    • ELISA to test binding to purified human complement components

    • Flow cytometry to measure complement regulator acquisition from human serum

    • Competition assays to determine if prafA and Pra1 bind the same sites on complement regulators

  • Functional complement assays:

    • Hemolytic assays to measure complement activation in the presence of prafA

    • C3b/C4b deposition assays on cells expressing different levels of prafA

    • Cofactor activity assays for Factor I-mediated cleavage of C3b/C4b

  • Cellular response measurements:

    • Phagocytosis assays with human neutrophils

    • Assessment of inflammatory cytokine production

    • Survival of D. discoideum in the presence of human serum

C. albicans Pra1 was shown to harbor multiple immune evasion functions: binding complement inhibitors on the surface, complexing C3 in solution, and acting as a decoy to block CR3-mediated fungal uptake . Comparative analysis could reveal which of these functions might be conserved in D. discoideum prafA.

What are promising avenues for investigating prafA's role in D. discoideum development and cell signaling?

Based on related protein functions in D. discoideum, several promising research directions emerge:

  • Developmental biology approaches:

    • Temporal expression analysis throughout D. discoideum life cycle

    • Spatial expression patterns during multicellular development

    • Phenotypic analysis of prafA mutants during development

    • Identification of developmental signaling pathways involving prafA

  • Cell density sensing mechanisms:

    • Investigation of prafA localization changes in response to cell density

    • Analysis of prafA's role in prestarvation response

    • Comparison with Dd-TRAP1, which translocates to mitochondria in response to cell density

    • Identification of potential prestarvation factors that might interact with prafA

  • Protein interaction networks:

    • Yeast two-hybrid or BioID proximity labeling to identify interaction partners

    • Phosphoproteomic analysis to identify potential regulatory sites

    • Transcriptional changes in response to prafA manipulation

The finding that Dd-TRAP1 enhances early developmental programs through novel prestarvation responses suggests that D. discoideum has evolved specialized mechanisms for adapting to environmental changes, which may involve multiple proteins including prafA.

How might structural biology approaches enhance our understanding of D. discoideum prafA function?

Structural characterization could significantly advance understanding of prafA function:

  • Structure determination methods:

    • X-ray crystallography of purified recombinant prafA

    • Cryo-electron microscopy for protein complexes

    • NMR spectroscopy for dynamic regions and interaction interfaces

    • Computational modeling based on homologous structures

  • Structural analysis targets:

    • Comparison with known structures of PRA1 family proteins

    • Identification of potential binding pockets and interaction surfaces

    • Mapping of conserved domains to the three-dimensional structure

    • Analysis of conformational changes upon binding to partners

  • Structure-guided experimental design:

    • Rational design of point mutations based on structural information

    • Fragment-based approaches to identify small molecule modulators

    • Engineering of modified proteins with enhanced or altered functions

While no high-resolution structure of any PRA1 family protein has been reported in the literature provided, structural biology approaches could reveal how these proteins achieve their diverse functions across different organisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.