Recombinant Dictyostelium discoideum Prespore protein Dd31 (spiA)

Shipped with Ice Packs
In Stock

Description

Gene Expression and Regulation

  • Developional Timing: spiA mRNA accumulates immediately prior to sporulation, peaking during culmination .

  • Induction: Expression is triggered by 8-Br-cAMP (20 mM) but not cAMP, indicating a role for cyclic nucleotide signaling in sporulation .

  • Mutant Phenotypes: spiA mRNA is absent in the stalky mutant, where prespore cells differentiate into stalk cells instead of spores .

Functional Role in Spore Stability

Disruption of spiA via homologous recombination (spiA⁻ strains) yields spores morphologically identical to wild-type but with significantly reduced long-term viability :

ConditionWild-Type ViabilityspiA⁻ ViabilityRescued Strain Viability
Freshly harvested spores100%100%100%
Submerged in buffer (11 days)10% survival0.001% survivalRestored to wild-type levels

The accelerated loss of viability in spiA⁻ spores under submerged conditions highlights Dd31’s role in maintaining structural integrity against osmotic stress .

Protein Interactions and Localization

Dd31 associates with the inner spore coat layer and resists solubilization by nonionic detergents but is extractable with SDS . While not directly interacting with cellulose-binding proteins like SP85 or SP65 (components of the spore coat matrix), genetic rescue experiments confirm that Dd31’s presence is necessary for proper spore coat architecture .

Research Applications and Tools

  • Antibody Production: Polyclonal antibodies against Dd31 were generated using a recombinant fusion protein containing a fragment of the spiA coding sequence, enabling its detection in Western blots and localization studies .

  • Genetic Rescue: Reintroduction of an intact spiA gene into spiA⁻ strains fully restores spore stability, validating the gene’s non-redundant function .

Key Research Findings

  1. Dd31 is dispensable for initial spore formation but essential for long-term survival under stress .

  2. Its detergent-resistant association with the spore coat suggests a structural role in preventing water ingress .

  3. Expression of spiA is tightly coupled to terminal differentiation, making it a marker for prespore cell commitment .

Unresolved Questions

  • The precise biochemical mechanism by which Dd31 stabilizes the spore coat remains unclear.

  • Potential cross-talk between Dd31 and cellulose-associated proteins (e.g., SP85/SP65) during coat assembly warrants further study .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your desired format in the order notes for our preparation.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery timelines, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us beforehand as additional charges will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is recommended. Minimize repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
spiA; DDB_G0289075; Prespore protein Dd31
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
spiA
Target Protein Sequence
MEHNNNPGTPQMSSEFPASTTQTSSSAAAYDNSSHFEKEQSLMRWEQDLKLRERALANNQ SAADITGPHVVVPAPATAHPRQANFPSSYPMIRLNLEEDIAIREYRQIVKFGIFVFLWEA AALVYNWVVSIGTIVYSAVDNFFLALFYMIVGVPTLYFLTRKLYRAASVPERARKSYAYL MALLGVVLFNIIFFVGFKRSGMNGLIWVISLFHNDHNAVGAMATVSLFFWFVGVFLTIAL FIMYLRLNNTKRQRGEIQNAGFREYIKSR
Uniprot No.

Target Background

Database Links
Protein Families
SCAMP family
Subcellular Location
Membrane; Multi-pass membrane protein. Spore coat. Note=Associated with the inner face of spore coat.

Q&A

What is the Dictyostelium discoideum Prespore protein Dd31 (spiA)?

Dd31, the product of the spiA gene, is a 30-kD protein specifically expressed in prespore cells and spores during the culmination stage of Dictyostelium development. The protein was identified using Western blot analysis with antibodies raised against a fusion protein containing a portion of the coding sequence . Structurally, the full-length protein consists of 269 amino acids and is associated with the inner face of spore coat fragments in a detergent-resistant manner . This location is consistent with its observed role in maintaining the stability of spores over extended periods .

What is the specific function of spiA in Dictyostelium discoideum?

The spiA gene product plays a crucial role in maintaining long-term spore viability in Dictyostelium discoideum. While not essential for initial spore formation or early viability, spiA is critical for spore stability during aging and environmental stress. Research using gene knockout techniques has demonstrated that spiA-deficient spores initially develop normally but lose viability significantly faster than wild-type spores, particularly under adverse conditions such as submersion in dilute buffer that prevents germination . After 11 days of submersion, spiA- spores show a remarkably severe 10^5-fold reduction in viability compared to only a 10-fold decrease in wild-type spores . Importantly, when an intact copy of the spiA gene is reinserted into spiA- strains, the stability of the spores is restored, confirming the direct role of this protein in spore maintenance .

How is spiA gene expression regulated during development?

The expression of spiA follows a specific spatial and temporal pattern during Dictyostelium development. Studies using spiA promoter/lacZ fusion constructs demonstrate that spiA expression initiates in prespore cells at the prestalk/prespore boundary near the apex of the developmental structure and progressively extends downward into the prespore mass as culmination continues . This creates a spatial gradient of expression that expands from the top of the prespore mass, intensifying until the activation front reaches the bottom, at which point the entire region stains darkly in beta-galactosidase assays .

Promoter analysis reveals that the spiA promoter can be deleted to within 301 bp of the transcriptional start site without affecting the strength, timing, or spatial localization of expression. Further 5' deletions from -301 to -175 reduce promoter strength incrementally, though timing and spatial expression remain unchanged. Deletions beyond -159 result in completely inactive promoters . This indicates the presence of important regulatory elements in the -301 to -159 region of the promoter.

What signaling pathways regulate spiA expression?

The cAMP-dependent protein kinase (PKA) pathway plays a central role in regulating spiA expression. Treatment of early developmental structures with 8-Br-cAMP, a membrane-permeant PKA agonist, activates intracellular PKA and induces precocious spiA expression and sporulation . Importantly, SpaA (Spores Absent A), a transcription factor, has been identified as a key downstream component of the PKA pathway that directly binds to the spiA promoter .

Chromatin immunoprecipitation (ChIP) experiments using SpaA-YFP fusion proteins have demonstrated that SpaA binds directly to the spiA promoter, and this binding is enhanced by PKA activation through 8Br-cAMP . This places SpaA downstream of PKA in the regulatory pathway controlling spiA expression. In fact, genome-wide analysis of SpaA binding sites through ChIP-sequencing reveals that SpaA binds to at least 117 (pre)spore promoters, including those of other transcription factors that activate spore genes, establishing SpaA as the major transcriptional inducer of sporulation .

The following table summarizes the key experimental evidence for PKA-dependent regulation of spiA:

Experimental ApproachKey FindingsSignificance
8Br-cAMP treatmentPrecocious induction of spiA expressionPKA activation is sufficient to trigger spiA expression
SpaA-YFP ChIP analysisEnhanced binding of SpaA to spiA promoter after PKA activationSpaA acts downstream of PKA
Gene knockout studiesReduced prespore gene expression in spaA- cellsSpaA is required for proper spiA expression
ChIP-seq of SpaA bindingSpaA binds to at least 117 (pre)spore promotersSpaA functions as a master regulator of sporulation

What phenotype results from spiA gene disruption in Dictyostelium?

While newly formed spiA- spores show normal viability, they demonstrate accelerated loss of viability compared to wild-type spores as they age. This impaired longevity is dramatically exacerbated under stress conditions such as submersion in dilute buffer that prevents germination. Quantitative viability assays reveal that after 11 days of submersion, the viability of spiA- spores decreases by a factor of 10^5, whereas wild-type spores show only a 10-fold reduction in viability . Importantly, the stability phenotype can be fully rescued by reintroducing an intact copy of the spiA gene into the mutant strain .

These findings highlight the specific role of spiA in maintaining spore integrity during extended dormancy and under stress conditions, rather than in the initial formation of viable spores.

What techniques are optimal for recombinant expression and purification of Dd31 protein?

Recombinant expression of Dd31 (spiA) protein has been successfully achieved in both prokaryotic and eukaryotic systems. For bacterial expression, E. coli has been used to produce His-tagged full-length Dd31 protein (1-269 amino acids) . The recombinant protein is typically purified to greater than 90% purity as determined by SDS-PAGE .

For expression in Dictyostelium itself, researchers have utilized vector systems that allow for efficient secretion of recombinant proteins. Studies have demonstrated that Dictyostelium can efficiently secrete recombinant products, including a soluble form of the normally cell surface-associated Dictyostelium glycoprotein (PsA) and heterologous proteins such as glutathione-S-transferase (GST) from Schistosoma japonicum . Yields of up to 20 mg/L of recombinant PsA have been obtained after purification from standard peptone-based growth medium .

When working with recombinant Dd31 protein:

  • Storage in Tris/PBS-based buffer with 6% trehalose at pH 8.0 is recommended

  • The lyophilized protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Addition of 5-50% glycerol as a final concentration is advised for long-term storage at -20°C/-80°C

  • Repeated freeze-thaw cycles should be avoided, with working aliquots stored at 4°C for up to one week

What experimental approaches have been used to study spiA function and regulation?

Multiple experimental approaches have been employed to investigate spiA function and regulation:

  • Gene Disruption via Homologous Recombination: This technique has been used to create spiA- strains, revealing the essential role of spiA in maintaining spore stability over time .

  • Promoter-Reporter Fusions: By creating strains containing spiA promoter/lacZ fusions, researchers have mapped the spatiotemporal pattern of spiA expression during development. This approach has revealed that expression initiates at the prestalk/prespore boundary and progressively expands downward through the prespore mass .

  • Promoter Deletion Analysis: Systematic deletion of portions of the spiA promoter has identified the minimal promoter region (-301 to -159) required for proper expression and identified regulatory elements within this region .

  • Pharmacological Activation: Treatment with 8Br-cAMP has demonstrated the role of PKA in activating spiA expression and has shown that all prespore cells are competent to express spiA when PKA is activated .

  • Western Blotting: Using antibodies raised against fusion proteins containing portions of the spiA coding sequence, researchers have identified the Dd31 protein as a 30-kD product associated with spore coat fragments .

  • Chromatin Immunoprecipitation (ChIP): ChIP analysis using SpaA-YFP fusion proteins has demonstrated direct binding of the transcription factor SpaA to the spiA promoter, placing spiA in a broader transcriptional network regulating sporulation .

How can researchers utilize spiA mutants for studying spore stability mechanisms?

The spiA mutants offer an excellent model system for investigating the mechanisms underlying spore stability and dormancy in Dictyostelium. These mutants provide several experimental advantages:

  • Specific Phenotype Isolation: The spiA- mutants display normal development and initial spore formation but show accelerated loss of viability during aging. This allows researchers to specifically study the mechanisms of spore maintenance without confounding effects on earlier developmental processes .

  • Stress Response Studies: The dramatically enhanced sensitivity of spiA- spores to submersion in dilute buffer provides an excellent system for studying stress response mechanisms in dormant spores. This model can be used to identify other genes and pathways that interact with spiA to maintain spore integrity under stress conditions .

  • Complementation Experiments: The ability to rescue the stability phenotype by reintroducing the spiA gene allows for structure-function studies through the creation of mutant versions of spiA with specific modifications to determine which domains or residues are critical for function .

  • Comparative Proteomic Analysis: Researchers can compare the protein composition of wild-type and spiA- spore coats to identify other components that may interact with Dd31 or compensate for its absence.

  • Evolutionary Studies: Since sporulation in Dictyostelium fruiting bodies evolved from amoebozoan encystation, with both processes being induced by cAMP acting on PKA , spiA mutants can be used to explore the evolutionary conservation of dormancy mechanisms across related amoebozoan species.

What is the relationship between SpaA transcription factor and spiA expression?

Recent research has identified SpaA (Spores Absent A) as a critical transcription factor that regulates spiA expression as part of a broader control of the sporulation program in Dictyostelium. ChIP experiments have demonstrated that SpaA binds directly to the spiA promoter, and this binding is enhanced by PKA activation . Expression of prespore genes, including spiA, is strongly reduced in spaA- cells, while expression of many spore stage genes is completely absent .

Genome-wide analysis through ChIP-sequencing has revealed that SpaA binds to at least 117 (pre)spore promoters, including those of other transcription factors that activate spore genes . Importantly, these other factors are not required for spaA expression, identifying SpaA as the major transcriptional inducer of sporulation .

The relationship between SpaA and spiA represents a key node in the regulatory network controlling sporulation in Dictyostelium:

  • PKA activation enhances SpaA binding to the spiA promoter and other (pre)spore gene promoters

  • SpaA activates expression of spiA and other genes required for proper spore formation and maintenance

  • SpaA also activates additional transcription factors that further regulate subsets of spore genes

  • The combined action of these transcription factors orchestrates the complex process of sporulation

What contradictory findings exist in the literature regarding spiA function?

While the literature on spiA is generally consistent regarding its role in spore stability, there are some nuances and potential contradictions in the reported findings that researchers should be aware of:

  • Temporal Expression Pattern: Some studies suggest that spiA expression follows a wave-like pattern that progresses from the apex to the base of the prespore mass during culmination , while others have reported a more uniform activation when PKA is stimulated throughout the prespore region . This apparent contradiction may reflect differences in experimental conditions or interpretation of the spatial gradient.

  • Severity of the Stability Phenotype: While all studies agree that spiA- spores show reduced viability over time, the magnitude of this effect and the conditions under which it is most pronounced may vary between studies. This could reflect differences in strain backgrounds or experimental conditions used for spore aging.

  • Regulatory Elements in the spiA Promoter: Different studies may highlight different regions of the spiA promoter as being critical for expression. This could reflect the complexity of the regulatory network controlling spiA expression, with multiple transcription factors potentially binding to different regions of the promoter.

  • Relationship to Other Spore Coat Proteins: The exact relationship between spiA and other spore coat proteins in maintaining spore stability may not be fully resolved, with potential redundancy or compensatory mechanisms that could complicate interpretation of single-gene knockout phenotypes.

What are the experimental considerations when performing ChIP analysis of factors binding to the spiA promoter?

When performing Chromatin Immunoprecipitation (ChIP) analysis to study factors binding to the spiA promoter, researchers should consider several important experimental factors:

  • Developmental Timing: Given the temporal regulation of spiA expression during culmination, the precise developmental stage at which ChIP samples are collected is critical. For optimal results, samples should be collected at multiple time points during culmination to capture the dynamic nature of protein-DNA interactions .

  • PKA Activation Status: Since PKA activation enhances binding of transcription factors like SpaA to the spiA promoter, the PKA status of the cells should be carefully controlled and documented. Experiments may include parallel samples with and without PKA activation (e.g., using 8Br-cAMP) to compare binding patterns .

  • Antibody Specificity: When using antibodies against potential binding factors, their specificity should be rigorously validated. For tagged proteins such as SpaA-YFP, controls should include untagged strains to assess background binding .

  • Cross-linking Conditions: The optimal cross-linking conditions (e.g., formaldehyde concentration, incubation time) may vary depending on the specific protein-DNA interaction being studied. Optimization experiments should be performed to determine the conditions that maximize signal-to-noise ratio.

  • Negative Control Regions: ChIP experiments should include amplification of genomic regions not expected to bind the factor of interest as negative controls. These may include housekeeping genes or regions not associated with sporulation.

  • Positive Control Regions: Including known binding sites for the factor of interest as positive controls helps validate the ChIP procedure and provides a reference for interpreting binding to the spiA promoter.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.