Recombinant Dictyostelium discoideum Probable carboxypeptidase S-like 2 (DDB_G0267984)

Shipped with Ice Packs
In Stock

Description

Introduction

Dictyostelium discoideum is a cellular slime mold recognized as a valuable model organism for studying developmental and cell biology due to its ease of use and simple life cycle . Recent studies suggest that Dictyostelium may serve as a source of novel lead compounds for pharmacological and medical research . One such compound is Recombinant Dictyostelium discoideum Probable carboxypeptidase S-like 2 (DDB_G0267984).

Overview of Dictyostelium discoideum as a Source of Drug Leads

Genome analyses reveal that D. discoideum has approximately 43 polyketide synthase genes . This suggests that Dictyostelium cellular slime molds produce an abundance of secondary metabolites that could be used as novel lead compounds for drug discovery .

Carboxypeptidases

Carboxypeptidases are enzymes that catalyze the hydrolysis of peptide bonds at the C-terminal end of proteins or peptides.

Tables for Data Presentation

Tables are used to organize data that is too detailed or complicated to be described adequately in the text, allowing the reader to quickly see the results . They can highlight trends or patterns in the data and make a manuscript more readable by removing numeric data from the text .

Table 1: How to Choose Between Tables, Figures, and Text to Present Data

Use a TableUse a FigureUse Text
To show many and precise numerical values and other specific data in a small spaceTo show trends, patterns, and relationships across and between datasetsWhen you don't have extensive data to present
To compare and contrast data values with several shared characteristics or variablesTo summarize research resultsWhen putting your data into a table would mean creating a table with 2 or fewer columns
To show the presence or absence of specific characteristicsTo present a visual explanation of a sequence of events, procedures, or characteristicsWhen the data that you are planning to present is irrelevant to the main study findings.

Other Compounds Isolated from Dictyostelium

  • Differentiation-Inducing Factors (DIFs): DIF-1, DIF-2, and DIF-3 are chlorinated alkylphenones that induce stalk-cell differentiation . DIF-1 is the most active, inducing stalk-cell differentiation in vitro at nanomolar levels .

  • Dictyopyrones: Dictyopyrones A–D promote morphogenesis of D. discoideum, inhibit spore formation, and promote stalk-cell formation in vitro . They also suppress cell growth in human leukemia K562 cells in vitro .

  • MPBD (4-methyl-5-n-pentylbenzene-1,3-diol): MPBD promotes stalk-cell and spore differentiation in D. discoideum under certain in vitro culture conditions . It also suppresses the growth of human leukemia K562 and HL-60 cells in vitro and possesses antimicrobial activities .

  • Monochasiols: Monochasiols A–H are chlorinated alkylresorcinols isolated from the fruiting bodies of D. monochasioides . Monochasiol A suppresses ConA-induced IL-2 production in Jurkat T cells without affecting cell viability .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
DDB_G0267984; Probable carboxypeptidase S-like 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-519
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0267984
Target Protein Sequence
MDKRKQSDYDNGKSKPTNGSKTTKFNLIKIIIRNLLIGILLMLVLNTIRFTSKQPKVEIL SPDHIDSFTTLSDIELAQRLAKATTFKTISFGESDEFDQYEPEFLKFHEFLKITFPKVHK YLKLNIIANYSLVYNWKGLDESLKPILLAGHIDVVPTLFLDKWTHPPFSGHIDDTYIWGR GTMDDKGSVMAILESVEDLLSQGFKPQRSIYFAFGHDEELGGNNGAFNINKYFDTNEIGP FEFILDEGLPILLPPVFPGLSKPIASVGITEKGAIDIKLSVTIVGGHSSMPRRESAIGVL AQAVSKLENNPPSPKLRETRLLFDFVGRECSLPYRFLFSNLWLFEPIISRVLSTKPTLDA LQRTTTALTIFNAGNKANVIPMEANATINFRVVPGDSTNDIIDHVNRVINDDRVKISKIS NIIEPAPVSSTTSKSFNLLQSTILQEFPDVVVAPTIMIANTDTRHYWNLTENIFRFCPMV LENSDLQRLHGIDERLTIKNYKQLVDFYYHLIKNTEKYL
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M20A family
Subcellular Location
Membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.