Recombinant Dictyostelium discoideum Probable cytochrome P450 525A1 (cyp525A1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
cyp525A1; DDB_G0272652; Probable cytochrome P450 525A1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-601
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
cyp525A1
Target Protein Sequence
MDTTKNNDEFDISYFLTCSIFGFILWILTEQILKYYNKTNKNNKYNLPKGPSFLKWFINY LFNFYDLKLSNNKEEDNNNNNNKSNNSLSQEELIEDTSENTVLKWFNQLNSDNYSVSFFG RPMIFTRDTTISKYILSSNNIDNYTKPPDSSGVLIRLAQNSILMSEGDQWRYHRSIINQP FSSKNVKLMIPTIITTINKLINHLNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNTIIIDIHSYCTKLTFDIIGKLSIGYDFNSIESSDNDNDNNDD DDISKQFDFILNEMIRPIRRFSSYLPLYNDIKLFKFLNELESIIKGAINSRSLITDNNNN KTYKKNFLLDNLLDDNVKEKDIIGNINTFLLAGHETSANLLTFIFYLLSTHNNVQNDLYN HLIENQKKKINKDNKFTEEDEDYQSIEFLDWVIYETLRLFPPAPMIGRTSKNDDILKSGN NNNNNNNNISIPSETLILISVYAIHRDPKLWKDPNIFNPYRWKNIENINNRSDFIPFSSG GRVCVGQKFSIVEARIIISKLILNFELSFNNLKSKPFKIYQRATLTPKYPVFLNFKKREN K
Uniprot No.

Target Background

Database Links
Protein Families
Cytochrome P450 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is cytochrome P450 525A1 in Dictyostelium discoideum?

Cytochrome P450 525A1 (cyp525A1) is a member of the cytochrome P450 superfamily identified in the social amoeba Dictyostelium discoideum. The protein consists of 601 amino acids and contains the characteristic heme-binding domain common to all cytochrome P450 enzymes. Based on its sequence characteristics, it is classified as a probable cytochrome P450 that likely catalyzes oxidative reactions involved in metabolic processes . The enzyme belongs to a diverse family of proteins that have been increasingly studied for their roles in development, chemical ecology, and secondary metabolism in D. discoideum.

How does CYP525A1 compare to other cytochrome P450 enzymes in D. discoideum?

D. discoideum possesses multiple cytochrome P450 enzymes that play various roles in its lifecycle. A comprehensive analysis reveals that CYP525A1 belongs to a different subfamily than the well-characterized CYP521A1, which functions in a terpene synthase-cytochrome P450 gene cluster. While CYP521A1 is known to catalyze the conversion of discoidol to discodiene (a novel trisnorsesquiterpene) , CYP525A1's specific substrates and products remain less characterized. The table below shows a comparison of key cytochrome P450 enzymes in D. discoideum:

Cytochrome P450Size (aa)Known FunctionExpression PatternAssociated Genes
CYP521A1~500Conversion of discoidol to discodienePeaks at 16 hr developmentClustered with DdTPS8
CYP525A1601Probable oxidative reactionsNot fully characterizedNot determined
CYP508C1~500Tested with discoidol (inactive)Peaks at 16 hr developmentNot in gene cluster
CYP519C1~500Not determinedPeaks at 16 hr developmentNot determined

How can recombinant CYP525A1 from D. discoideum be expressed and purified for biochemical studies?

The expression and purification of recombinant CYP525A1 can be approached using methodologies similar to those employed for other D. discoideum cytochrome P450 enzymes. A recommended protocol involves:

  • Gene amplification and vector construction: Amplify the complete CYP525A1 open reading frame using RT-PCR from D. discoideum RNA, preferably isolated during developmental stages when the gene is expressed. Clone the amplified gene into a suitable expression vector (e.g., pET32a or pRSFDuet-1) .

  • Co-expression with cytochrome P450 reductase: For functional studies, co-express CYP525A1 with a cytochrome P450 reductase (such as redB from D. discoideum) to ensure electron transfer required for catalytic activity. This can be accomplished using dual-expression vectors like pRSFDuet-1, which allows simultaneous expression of both proteins .

  • Expression system selection: Express in E. coli BL21(DE3)-Star strain, which has been successful for other D. discoideum P450 enzymes. Culture at 28-30°C after IPTG induction to optimize protein folding .

  • Purification strategy:

    • Harvest cells and disrupt using methods like sonication or a TissueLyser

    • Isolate membrane fractions through differential centrifugation

    • Solubilize membrane proteins using mild detergents

    • Purify using immobilized metal affinity chromatography if a His-tag was included

    • Further purify by ion exchange and size exclusion chromatography if needed

Protein expression validation can be performed using SDS-PAGE and Western blotting, while functional validation requires activity assays with appropriate substrates.

What experimental approaches can be used to study the enzymatic activity of recombinant CYP525A1?

Several complementary approaches can be employed to characterize the enzymatic activity of recombinant CYP525A1:

  • In vitro reconstitution assays: Using purified CYP525A1 and cytochrome P450 reductase with potential substrates in the presence of NADPH. Products can be extracted with organic solvents (e.g., ethyl acetate, benzene-d6) and analyzed .

  • Whole-cell biotransformation: Express CYP525A1 and reductase in E. coli, then add potential substrates to the culture medium and analyze the products formed. This approach has been successful for other D. discoideum P450 enzymes .

  • Substrate screening: Test a range of potential substrates including:

    • Terpenoids (based on the known activity of related CYP521A1)

    • Fatty acids (common P450 substrates)

    • Polyketides (relevant to D. discoideum secondary metabolism)

    • Various xenobiotics

  • Analytical methods for product identification:

    • GC-MS for volatile products

    • LC-MS for non-volatile products

    • NMR for structural elucidation of novel metabolites

    • Headspace collection with solid-phase microextraction for volatile compounds

  • Inhibition studies: Using known cytochrome P450 inhibitors to confirm P450-dependent reactions and characterize inhibition patterns .

How can the substrate specificity of CYP525A1 be determined?

Determining the substrate specificity of CYP525A1 requires a systematic approach:

  • Homology-based prediction: Analyze the substrate recognition sites in CYP525A1 sequence and compare with other characterized P450 enzymes to predict potential substrate classes .

  • High-throughput screening: Test substrate libraries using:

    • Spectral binding assays that measure changes in the P450 heme spectrum upon substrate binding

    • NADPH consumption assays that monitor cofactor depletion during catalysis

    • Product formation assays using LC-MS or GC-MS detection

  • Template-based approach: Apply a template system similar to those used for human CYP1A2 to model potential substrate interactions with CYP525A1 .

  • Co-expression studies with potential metabolic partners: Similar to how DdTPS8 and CYP521A1 work together, identify potential metabolic partners that may provide substrates for CYP525A1 .

  • Kinetic parameter determination: For identified substrates, determine key enzymatic parameters:

ParameterMethodExpected Range
KmSubstrate concentration seriesTypically µM to mM range
kcatTime-course analysisVaries by substrate
Inhibition constants (Ki)Inhibitor concentration seriesSubstrate-dependent
Optimal pH and temperatureActivity assays at varying conditionsOrganism-specific

What is the relationship between CYP525A1 and the development of D. discoideum?

While direct evidence for CYP525A1's role in D. discoideum development is limited, insights can be drawn from studies of related cytochrome P450 enzymes:

  • Developmental expression patterns: Several D. discoideum cytochrome P450 genes show distinctive expression patterns during development. For example, CYP521A1 transcript levels peak at 16 hours during the developmental program, coinciding with critical morphogenetic events . Gene expression analysis during the 24-hour developmental cycle of D. discoideum should be conducted to determine when CYP525A1 is most active.

  • Potential involvement in signaling molecule production: Cytochrome P450 enzymes in D. discoideum have been implicated in the metabolism of signaling molecules that regulate development. For instance, the DdTPS8-CYP521A1 gene cluster produces discodiene, and knockout of DdTPS8 leads to slow developmental progression . CYP525A1 might similarly be involved in producing or metabolizing developmental signals.

  • DIF-1 metabolism: Differentiation-inducing factor 1 (DIF-1), a chlorinated polyketide crucial for D. discoideum stalk cell differentiation, undergoes metabolism through multiple steps. As noted in search result , "There is evidence that there are possibly 12 intermediates in the breakdown of DIF-1. What P450s might be involved?" CYP525A1 could potentially catalyze one of these steps .

  • Experimental approach: To determine CYP525A1's developmental role, a knockout strain should be generated and phenotyped throughout development, with particular attention to:

    • Timing of aggregation, mound formation, and culmination

    • Proportions of different cell types

    • Fruiting body morphology

    • Response to environmental stressors

How does CYP525A1 compare to human cytochrome P450 enzymes in terms of structure and function?

Cytochrome P450 enzymes are found across all domains of life and exhibit varying degrees of structural and functional conservation. Comparison of CYP525A1 with human P450s reveals:

  • Structural features: While maintaining the core P450 fold, CYP525A1 likely shows substantial differences in substrate binding regions compared to human P450s. Human CYP450s typically belong to families 1, 2, and 3, which primarily mediate oxidative reactions in drug metabolism, while CYP525A1 belongs to a distinct family evolved for specialized metabolism in D. discoideum .

  • Functional comparison: Human P450s are primarily involved in xenobiotic metabolism and endogenous compound synthesis (steroids, fatty acids, etc.), whereas D. discoideum P450s like CYP525A1 likely participate in specialized secondary metabolism and developmental processes .

  • Evolutionary divergence: Phylogenetic analysis places CYP525A1 in a distinct evolutionary lineage from human P450s, reflecting the early divergence of social amoebae from the lineage leading to animals .

  • Inhibition profiles: CYP525A1 would likely show different inhibition patterns compared to human P450s when tested with typical inhibitors used in drug metabolism studies .

  • Potential as model system: Despite these differences, studying CYP525A1 may provide insights into fundamental mechanisms of P450 function that are conserved across species, particularly in understanding how structural variations influence substrate specificity and catalytic efficiency .

What role might CYP525A1 play in the chemical ecology of D. discoideum?

D. discoideum exists in soil environments where it interacts with diverse microorganisms and potential predators. Cytochrome P450 enzymes may contribute to these ecological interactions:

  • Defense compound production: CYP525A1 might be involved in synthesizing compounds that deter predators or inhibit competing microorganisms. The related CYP521A1 produces discodiene, a trisnorsesquiterpene that could have ecological functions .

  • Detoxification of environmental compounds: Like other P450 enzymes, CYP525A1 may help detoxify harmful compounds encountered in the soil environment .

  • Chemical communication: D. discoideum uses volatile compounds for various signaling purposes. CYP525A1 might be involved in metabolizing or producing these signaling molecules, as seen with other P450-terpene synthase systems .

  • Bacterial interaction: D. discoideum feeds on bacteria and has evolved mechanisms to resist bacterial pathogens. CYP525A1 might participate in metabolizing bacterial compounds or producing antimicrobial agents .

  • Experimental approaches to investigate these ecological roles could include:

    • Comparative analysis of metabolite profiles between wild-type and CYP525A1 knockout strains

    • Testing CYP525A1 activity against compounds derived from bacteria, fungi, or plants found in D. discoideum's natural habitat

    • Examining CYP525A1 expression in response to different ecological challenges

What are the challenges in working with recombinant CYP525A1 and how can they be addressed?

Working with recombinant cytochrome P450 enzymes presents several technical challenges:

  • Protein stability issues: P450 enzymes often have limited stability in vitro. To address this:

    • Use optimized buffer conditions with glycerol (30-50%) for storage

    • Include protease inhibitors during purification

    • Store at -80°C for long-term or -20°C with 50% glycerol for medium-term storage

  • Expression of active enzyme: Achieving proper folding and heme incorporation can be challenging. Strategies include:

    • Lowering expression temperature (16-28°C)

    • Co-expression with chaperones

    • Adding δ-aminolevulinic acid (a heme precursor) to growth medium

    • Using specialized E. coli strains (like BL21(DE3)-Star)

  • Reductase coupling: CYP525A1 requires electron donation from a suitable reductase. Approaches include:

    • Co-expression with redB (D. discoideum's P450 reductase)

    • Creation of fusion proteins linking CYP525A1 and reductase

    • Adding purified reductase in reconstitution systems

  • Substrate identification: Finding physiological substrates can be challenging. Consider:

    • Starting with substrates of related enzymes (like CYP521A1)

    • Using metabolomic approaches to compare wild-type and knockout D. discoideum

    • Testing substrate classes common for P450 enzymes (terpenoids, fatty acids, etc.)

How can genetic manipulation approaches be used to study CYP525A1 function in vivo?

Several genetic approaches can elucidate CYP525A1 function in living D. discoideum:

  • Gene knockout: Generate a CYP525A1 knockout strain using:

    • CRISPR-Cas9 technology

    • Homologous recombination with a disruption cassette

    • Insertional mutagenesis (similar to the approach used for DdTPS8)

  • Gene overexpression: Create strains overexpressing CYP525A1 to observe gain-of-function phenotypes:

    • Use constitutive promoters (like actin15) for vegetative expression

    • Use developmentally regulated promoters for stage-specific expression

  • Reporter gene fusion: Create CYP525A1-GFP fusions to monitor:

    • Subcellular localization

    • Expression patterns during development

    • Protein dynamics in living cells

  • Complementation studies: Reintroduce wild-type or mutated CYP525A1 into knockout strains to:

    • Confirm phenotype causality

    • Identify critical residues for enzyme function

    • Test structure-function hypotheses

  • Multi-omics analysis: Compare knockout and wild-type strains using:

    • Transcriptomics to identify affected gene networks

    • Metabolomics to identify changes in metabolite profiles

    • Proteomics to identify altered protein interactions

What analytical methods are most suitable for studying CYP525A1-catalyzed reactions?

To effectively characterize reactions catalyzed by CYP525A1, several analytical approaches should be considered:

  • Chromatographic methods:

    • Gas Chromatography-Mass Spectrometry (GC-MS): Ideal for volatile and semi-volatile compounds, particularly useful if CYP525A1 metabolizes terpenoids similar to CYP521A1

    • Liquid Chromatography-Mass Spectrometry (LC-MS): Better suited for non-volatile, polar, or thermally unstable metabolites

    • High-Performance Liquid Chromatography (HPLC): For quantitative analysis of metabolites with appropriate standards

  • Spectroscopic techniques:

    • UV-Visible spectroscopy: To monitor the characteristic spectral shifts of P450 enzymes upon substrate binding

    • Nuclear Magnetic Resonance (NMR): For detailed structural elucidation of novel metabolites

    • Infrared spectroscopy: To identify functional groups in metabolites

  • Specialized collection methods:

    • Solid Phase Microextraction (SPME): For volatile compounds in headspace

    • Liquid-liquid extraction: Using appropriate solvents like ethyl acetate or benzene-d6

  • Real-time monitoring approaches:

    • NADPH consumption assays: To measure enzyme activity in real-time

    • Oxygen consumption measurements: Using oxygen electrodes to monitor reaction progress

    • Fluorescence-based assays: If suitable fluorogenic substrates can be identified

  • Recommended workflow for unknown reactions:

    • Initial screening using GC-MS or LC-MS to detect product formation

    • Optimization of separation conditions for target compounds

    • Scale-up reactions for product isolation

    • Structural confirmation using NMR and high-resolution MS

    • Kinetic characterization using optimized analytical methods

How can studies of CYP525A1 contribute to our understanding of metabolic evolution?

Research on CYP525A1 can provide valuable insights into metabolic evolution across several dimensions:

  • Evolutionary trajectory of P450 enzymes: CYP525A1 represents a distinct evolutionary lineage that can be compared with P450s from other organisms to understand how these enzymes diversified across different kingdoms of life. D. discoideum's position at the evolutionary crossroads between unicellular and multicellular life forms makes its P450 enzymes particularly interesting for understanding how metabolic capabilities evolved during this transition .

  • Gene clustering patterns: The presence of gene clusters like DdTPS8-CYP521A1 in D. discoideum suggests that metabolic gene clustering evolved before the emergence of plants and fungi, which commonly display such arrangements. Investigation of whether CYP525A1 exists in a similar cluster could provide insights into the evolution of metabolic pathways .

  • Functional diversification: Comparing substrate specificities and reaction mechanisms of CYP525A1 with other D. discoideum P450s can reveal how gene duplication and functional divergence shaped metabolic capabilities .

  • Comparison across Dictyostelid species: Examining orthologs of CYP525A1 in related species within the four evolutionary groups of Dictyostelia could reveal how P450 functions adapted during the evolution of this clade .

  • Possible research approaches:

    • Phylogenetic analysis of CYP525A1 homologs across species

    • Comparative biochemical characterization of CYP525A1 and related enzymes

    • Analysis of synteny and gene clustering patterns around CYP525A1

    • Functional complementation studies across species

Can CYP525A1 serve as a model for understanding human cytochrome P450 enzymes?

Despite evolutionary distance, CYP525A1 can provide valuable insights into human P450 function:

  • Fundamental mechanistic insights: Core aspects of P450 catalysis are conserved across species. Studying CYP525A1's catalytic mechanism can reveal fundamental principles applicable to human P450s .

  • Structural determinants of specificity: Comparative analysis of substrate binding regions between CYP525A1 and human P450s can help identify key structural features that determine substrate specificity .

  • Experimental advantages:

    • D. discoideum is a haploid organism, facilitating genetic manipulation

    • CYP525A1 likely has specialized functions, potentially making structure-function relationships clearer

    • The simpler cellular context may allow cleaner biochemical characterization

  • Testing computational models: CYP525A1 could serve as a test case for computational approaches like the CYP-Template systems described for human CYP1A2, helping validate these models across evolutionary distance .

  • Potential limitations:

    • Different cellular localization and membrane composition

    • Evolutionary distance limiting direct translational relevance

    • Potentially distinct regulatory mechanisms

What are promising future research directions for CYP525A1?

Several promising research directions could advance our understanding of CYP525A1:

  • Complete structural characterization: Determining the crystal structure of CYP525A1 would provide invaluable insights into its substrate binding and catalytic mechanism. This could be approached through X-ray crystallography or cryo-electron microscopy .

  • Systematic substrate screening: Developing a comprehensive substrate profile through high-throughput screening approaches would help define CYP525A1's biochemical function .

  • Integration with metabolomic approaches: Combining CYP525A1 characterization with untargeted metabolomics of D. discoideum could identify novel metabolites and pathways involving this enzyme .

  • Investigation of potential gene clusters: Examining the genomic neighborhood of CYP525A1 for functionally related genes could reveal whether it participates in a biosynthetic pathway similar to the DdTPS8-CYP521A1 system .

  • Developmental regulation studies: Detailed analysis of CYP525A1 expression patterns during D. discoideum development and in response to environmental signals could help elucidate its biological role .

  • Protein engineering applications: Once well-characterized, CYP525A1 could be engineered for biotechnological applications such as biocatalysis of challenging chemical transformations .

  • Three-way comparative studies: Comparing CYP525A1 with both bacterial and mammalian P450s could position it as a bridge for understanding P450 evolution across all domains of life .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.