Recombinant Dictyostelium discoideum Probable Delta (5) fatty acid desaturase C (DDB_G0294553)

Shipped with Ice Packs
In Stock

Description

Biochemical Function

Delta(5) desaturases catalyze the desaturation of fatty acids by introducing a double bond at the fifth carbon. DDB_G0294553 was functionally validated through:

  • Overexpression in D. discoideum: Resulted in lipid profiles enriched with Delta(5)-desaturated products .

  • Heterologous expression in Saccharomyces cerevisiae: Demonstrated gain-of-function activity, confirming its role in fatty acid metabolism .

Substrate Specificity

While D. discoideum harbors two functional Delta(5) desaturases, DDB_G0294553 exhibits distinct substrate preferences compared to its paralog. Specific substrates and products remain under investigation, but its activity aligns with the broader role of Delta(5) desaturases in synthesizing polyunsaturated fatty acids (PUFAs) .

Recombinant Production and Handling

The enzyme is produced via E. coli expression and purified using Ni-NTA affinity chromatography. Key handling notes:

  • Reconstitution: Suspend in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for stability .

  • Storage: Aliquot and store at -20°C/-80°C to prevent degradation .

Research Applications

DDB_G0294553 serves as a critical tool in:

  1. Fatty Acid Biosynthesis Studies: Elucidating pathways for PUFA production.

  2. Structural Biology: Crystallography and enzyme kinetics research .

  3. Biotechnology: Potential applications in engineering organisms to produce specific lipid profiles, as seen in soybean transformations using analogous enzymes .

Comparative Analysis with Related Enzymes

FeatureDDB_G0294553Other Delta(5) Desaturases
Sequence Identity42% to Mortierella alpina desaturase Varies by organism (e.g., 38.6% to M. alpina)
Domain ArchitectureCytochrome b5 + desaturase domainCytochrome b5 + desaturase domain
Substrate SpecificityUnder investigationDiverse (e.g., linoleic acid → GLA)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its use.
Synonyms
DDB_G0294553; Probable Delta(5 fatty acid desaturase C; Delta-5 fatty acid desaturase C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-459
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0294553
Target Protein Sequence
MENEKKLFKKLYSWKEISKHNTIENGIWISIDGLVYDITKFIKHHPGGEQVLILAAGRDV TNLFESYHPMTDLPSKMLKQYEIGQVSTMEFPKYVEKSKFYSTLKERVREHFKKSNKDPK FAFGIIARLIFVYWFLITSYYVSHYAFIENFYLNCLLAIVYSLSNSLFSLHMMHDACHSA ISHNPKVWKWLGATYDLFIGASFFYWCNQHVIGHHVYTNIRNADPDIGDSEVDFRIVTPY QNKYWIYKYQHIYAPFLYGLYSIKYRLCDYSVFTEGSIGRVRTANASNFEIISFIIGKLV FIVFRFIIPLQYHSLVNLLTYFFIAEFFFGLYLSFGFQVSHSADNLKIVATSVNENDEPT NVDEDWAIHQIKTTQDYGINSYMCLFFSGGVNLQVVHHLFPSISQEYYGELVPIIKKVCD EYDVHYNIQPTFYAAFKSHIDFLYNMGNNENYVRKSVTD
Uniprot No.

Target Background

Database Links
Protein Families
Fatty acid desaturase type 1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of DDB_G0294553?

DDB_G0294553 is a probable Delta(5) fatty acid desaturase from Dictyostelium discoideum with a full length of 459 amino acids. The protein contains an N-terminal cytochrome b5 domain that shares 43% identity with cytochrome b5 of Oryza sativa, while the whole sequence shares 42% identity with the Delta5 desaturase of Mortierella alpina . Like other fatty acid desaturases, its primary function is to introduce double bonds at specific positions in fatty acid chains, particularly at the Delta-5 position, which is crucial for the biosynthesis of polyunsaturated fatty acids .

How does DDB_G0294553 differ from other Delta(5) desaturases in Dictyostelium discoideum?

Dictyostelium discoideum is notable for having two functional Delta(5) fatty acid desaturase genes, making it the first organism confirmed to possess dual Delta(5) desaturase functionality . While both enzymes catalyze similar reactions, they may have different substrate specificities, cellular localizations, or regulatory mechanisms that allow for more nuanced control of fatty acid metabolism in this organism . Detailed comparative analysis of substrate preferences has been conducted between these two enzymes, providing insights into their evolutionary and functional divergence .

What is the genomic structure of the DDB_G0294553 gene?

The cDNA encoding DDB_G0294553 is approximately 1565 nucleotides in length, with the deduced amino acid sequence comprising 467 amino acid residues . The genomic DNA sequence has been amplified from D. discoideum and analyzed to understand its structure, including exon-intron boundaries and regulatory elements . This information is valuable for researchers interested in gene expression studies or genetic manipulation of this desaturase.

What are the recommended methods for overexpressing DDB_G0294553 in experimental systems?

For overexpression studies, researchers have successfully used both homologous expression in D. discoideum and heterologous expression in yeast (Saccharomyces cerevisiae) . To express DDB_G0294553 in D. discoideum, the gene can be cloned into appropriate expression vectors with strong promoters suitable for this organism. For yeast expression systems, researchers have employed gain-of-function mutations to confirm the desaturase activity . In both cases, lipid analysis by gas chromatography is typically performed to detect the accumulation of Delta(5)-desaturated products, confirming the functional expression of the enzyme .

How can researchers measure DDB_G0294553 enzyme activity in vitro?

To assess enzyme activity, researchers typically analyze the fatty acid composition of lipids extracted from cells expressing DDB_G0294553 compared to control cells . Techniques such as gas-liquid chromatography (GLC) are employed to separate and quantify fatty acid methyl esters. The desaturase activity is then evaluated by measuring the product-to-precursor ratios, also known as desaturation indices . These ratios (such as 20:4/20:3 for Delta(5) desaturase) reflect the enzyme's capacity to introduce double bonds at specific positions in fatty acid substrates .

What purification strategies are effective for obtaining functional recombinant DDB_G0294553?

Recombinant DDB_G0294553 can be produced with a histidine tag (His-tag) to facilitate purification . The protein is typically expressed in E. coli systems, followed by affinity chromatography using nickel or cobalt resins that bind the His-tagged protein. After elution with imidazole, additional purification steps may include ion-exchange chromatography or size-exclusion chromatography to achieve high purity. Since desaturases are membrane-associated proteins, detergents or lipid reconstitution may be necessary to maintain protein folding and activity during purification procedures.

How can researchers determine the substrate specificity of DDB_G0294553?

Substrate specificity of DDB_G0294553 can be determined through in vivo feeding experiments or in vitro enzyme assays . In the feeding approach, cells expressing the recombinant enzyme are supplemented with various potential fatty acid substrates, followed by lipid extraction and analysis to identify which substrates were desaturated. For in vitro assays, the purified enzyme can be incubated with different fatty acyl-CoA substrates in the presence of necessary cofactors (e.g., NADH, cytochrome b5, ferredoxin), followed by detection of the desaturated products using GC-MS or LC-MS/MS technologies .

What role does the cytochrome b5 domain play in DDB_G0294553 function?

The N-terminal cytochrome b5 domain in DDB_G0294553 plays a critical role in the electron transport required for desaturation reactions . This domain contains a heme prosthetic group that accepts electrons from NADH via cytochrome b5 reductase and transfers them to the catalytic center of the desaturase. The fusion of the cytochrome b5 domain with the desaturase domain in a single polypeptide represents an efficient arrangement for electron flow, distinguishing it from systems where cytochrome b5 acts as a separate protein. Mutations in the conserved histidine residues of this domain typically abolish desaturase activity, highlighting its essential role in enzyme function .

How is DDB_G0294553 activity regulated in Dictyostelium discoideum?

While the search results don't provide specific information on the regulation of DDB_G0294553 in D. discoideum, fatty acid desaturases are generally regulated at multiple levels including transcriptional control, post-translational modifications, and feedback inhibition by products. In other organisms, desaturase expression is often influenced by environmental factors such as temperature, nutrient availability, and developmental stage. Researchers investigating regulation should consider examining promoter elements, potential transcription factor binding sites, and expression patterns during different phases of the D. discoideum life cycle.

What can be learned from comparing the two Delta(5) desaturases in Dictyostelium discoideum?

The presence of two functional Delta(5) desaturases in D. discoideum offers a unique opportunity to study enzyme evolution and specialization . Comparative analysis of their expression patterns, subcellular localization, and substrate preferences can provide insights into why this organism maintains dual enzymatic systems for similar biochemical reactions. Research has been conducted on the substrate specificities of both enzymes, which may reveal complementary roles in fatty acid metabolism or adaptation to different environmental conditions . Understanding these differences could also inform synthetic biology approaches for engineering desaturases with desired specificity profiles.

How do Delta(5) desaturase activities in Dictyostelium relate to human metabolic processes?

Though Dictyostelium is evolutionarily distant from humans, studies of its Delta(5) desaturases can provide valuable insights into fundamental aspects of fatty acid metabolism relevant to human health . In humans, Delta(5) desaturase activity (encoded by FADS1) is implicated in the metabolism of polyunsaturated fatty acids and has been associated with insulin sensitivity . Research in Dictyostelium can help establish conserved mechanisms of enzyme function, substrate recognition, and regulation that may be applicable across species. Additionally, as a simpler model organism, Dictyostelium can facilitate the screening of compounds that modulate desaturase activity, potentially leading to therapeutic approaches for metabolic disorders .

How can DDB_G0294553 be used to study the relationship between desaturase activity and insulin resistance?

Research has established connections between desaturase activities and insulin resistance in mammals . DDB_G0294553 can serve as a model system to investigate the molecular mechanisms behind this relationship. By expressing DDB_G0294553 in mammalian cell lines or creating transgenic models with modified desaturase activity, researchers can study how changes in fatty acid composition affect insulin signaling pathways. Specifically, researchers could examine how altered ratios of saturated to unsaturated fatty acids in membrane phospholipids influence membrane fluidity and the function of insulin receptors . These studies could provide valuable insights into the pathogenesis of insulin resistance and potential therapeutic approaches.

What experimental approaches can be used to study the impact of DDB_G0294553 on membrane composition and cellular function?

To investigate the impact of DDB_G0294553 on membrane composition, researchers can employ cells with varying expression levels of the enzyme (overexpression, knockout, or knockdown) followed by comprehensive lipidomic analysis . Techniques such as mass spectrometry-based lipidomics can profile the changes in membrane phospholipids, particularly the incorporation of desaturated fatty acids. Biophysical methods including fluorescence anisotropy and differential scanning calorimetry can assess alterations in membrane fluidity and phase behavior. Functional consequences can be evaluated by examining membrane-associated processes such as signal transduction, vesicle trafficking, or organelle dynamics in these modified cellular systems .

How might dietary interventions affect DDB_G0294553 activity or expression?

While the search results don't directly address dietary effects on DDB_G0294553, studies in humans have shown that different types of dietary fats can influence desaturase indices . In a research context, Dictyostelium could be grown in media supplemented with various fatty acids to examine how substrate availability affects desaturase expression and activity. For instance, providing abundant saturated fatty acid precursors might upregulate desaturase expression to maintain membrane fluidity, while pre-formed unsaturated fatty acids might suppress desaturase activity through feedback inhibition . These experiments could model dietary interventions and provide insights into nutritional modulation of fatty acid metabolism.

What are the potential evolutionary implications of Dictyostelium having two functional Delta(5) desaturases?

The presence of two functional Delta(5) desaturases in Dictyostelium discoideum raises intriguing evolutionary questions . This duplication may represent an adaptation providing metabolic flexibility, allowing the organism to respond to varying environmental conditions or developmental stages. Comparative genomics approaches examining the presence of these genes across related species could reveal when the gene duplication occurred and whether it correlates with specific ecological adaptations. Researchers might investigate whether the two desaturases show different expression patterns during the complex life cycle of Dictyostelium, potentially supporting distinct metabolic needs during unicellular versus multicellular phases .

How might CRISPR-Cas9 genome editing be applied to study DDB_G0294553 function?

CRISPR-Cas9 technology offers powerful approaches for investigating DDB_G0294553 function through precise genetic modifications. Researchers could create knockout strains to assess the physiological consequences of DDB_G0294553 deficiency, particularly in the context of the other Delta(5) desaturase present in Dictyostelium. Site-directed mutagenesis of conserved residues (such as histidine boxes) could identify amino acids critical for catalytic activity or substrate specificity. Knock-in strategies introducing reporter tags (e.g., fluorescent proteins) could enable visualization of protein localization and dynamics within living cells. Additionally, CRISPRi (interference) or CRISPRa (activation) approaches could be employed to modulate expression levels without completely eliminating the gene function.

What computational approaches can be used to predict substrate binding and catalytic mechanisms of DDB_G0294553?

Advanced computational methods can provide valuable insights into the molecular functioning of DDB_G0294553. Homology modeling based on crystal structures of related desaturases can predict the three-dimensional structure of the enzyme, particularly the arrangement of transmembrane domains and the configuration of the active site. Molecular docking simulations can identify potential binding poses of different fatty acid substrates and estimate binding affinities. Molecular dynamics simulations can explore the dynamic behavior of the enzyme-substrate complex in a membrane environment, including conformational changes during catalysis. Quantum mechanics/molecular mechanics (QM/MM) approaches could investigate the electron transfer mechanisms involving the cytochrome b5 domain and the formation of double bonds in the substrate . These computational predictions can guide experimental design and interpretation of biochemical data.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.