Recombinant Dictyostelium discoideum Probable derlin-1 homolog (derl1)

Shipped with Ice Packs
In Stock

Description

Key Domains:

  • Transmembrane domains: Critical for ER membrane integration.

  • Conserved structural motifs: Enable interaction with ERAD machinery components like VCP (valosin-containing protein) .

Production Systems and Recombinant Variants

Recombinant Derl1 is produced using diverse expression systems, as detailed below:

Table 1: Recombinant Derl1 Products for Dictyostelium discoideum

Product CodeExpression SystemPurityNotes
CSB-CF709711DKKE. coli (in vitro)≥85%Full-length protein
CSB-YP709711DKK1Yeast≥85%Partial sequence
CSB-EP709711DKK1Baculovirus≥85%Partial sequence
MBS7013708Cell-free expression≥85%Hypothetical protein DDB_G0288833

These variants enable flexibility in experimental design, with partial sequences often used for domain-specific studies .

3.1. ERAD Pathway Studies

Recombinant Derl1 is instrumental in dissecting ERAD mechanisms in Dictyostelium. Its role in retrotranslocation has been validated through biochemical assays, where it interacts with VCP to mediate protein degradation .

3.2. Protein Interaction Networks

Studies leverage recombinant Derl1 to map interactions with ERAD components, such as ubiquitin ligases and chaperones, using techniques like co-immunoprecipitation .

Technical Considerations

  • Purity and Validation: Products are validated via SDS-PAGE and functional assays (e.g., ATPase activity assays for VCP interaction) .

  • Storage: Stable at -80°C in Tris-based buffer (pH 8.0) with glycerol .

Future Directions

  • Drug Discovery: Derlin-1 is a potential target for diseases linked to protein misfolding (e.g., cystic fibrosis) .

  • Comparative Studies: Evolutionary analysis of ERAD pathways across species using Dictyostelium Derl1 .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
derl1; DDB_G0288833; Probable derlin-1 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-242
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
Target Protein Sequence
MDGVKEWFNSIPPVSRYMFAIFLGIPVLAAMHLISFNYLYLDFTFTFKHFHLWRLITAPC IISSLGPMFLFNLIFFYQYTTRLESLNYAGKSDDYLFCIIFISICNIIFGLIFEYYFLGT MTIMSLIYIYSRMNPTGTSNFYGFFSFKTIYLPWVFLVAHFLQTGHPPYSDFLAIVSGHI FFYLTDIYPRANGVPALIKTPKFITNIFNKGDRNPNNVRRDPRTGRPIQEGGYNWGQGHA LG
Uniprot No.

Target Background

Function
This protein may participate in the degradation of specific misfolded endoplasmic reticulum (ER) luminal proteins. It may also be involved in endoplasmic reticulum stress-induced pre-emptive quality control, a mechanism that selectively reduces the translocation of newly synthesized proteins into the ER and redirects them to the cytosol for proteasomal degradation.
Database Links
Protein Families
Derlin family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the functional role of derlin-1 homolog in Dictyostelium discoideum?

Derlin-1 homolog in Dictyostelium discoideum functions as a critical component of the endoplasmic reticulum-associated degradation (ERAD) pathway, specifically for misfolded lumenal proteins . Similar to human derlin-1, it likely forms channels enabling the retrotranslocation of misfolded proteins from the ER lumen into the cytosol where they undergo ubiquitination and subsequent proteasomal degradation . The protein may also mediate interactions between other components of the ERAD machinery, such as potential VCP homologs, and the targeted misfolded proteins . The conservation of this protein across evolutionary distant organisms like humans and Dictyostelium suggests its fundamental importance in cellular protein quality control mechanisms .

What expression systems are available for producing recombinant Dictyostelium discoideum probable derlin-1 homolog?

Multiple expression systems have been developed and validated for the production of recombinant Dictyostelium discoideum probable derlin-1 homolog, each with distinct advantages depending on research requirements. The available systems include:

Expression SystemProduct Code ExampleFeatures
In vitro E. coliCSB-CF709711DKKHigh yield, cost-effective, potential inclusion bodies
YeastCSB-YP709711DKK1Post-translational modifications, proper folding
BaculovirusCSB-BP709711DKK1Insect cell expression, complex modifications
Mammalian cellCSB-MP709711DKK1Native-like folding and modifications
In Vivo Biotinylated E. coliCSB-EP709711DKK1-BPre-labeled for detection and purification

Selection should be based on experimental needs, particularly regarding protein folding requirements, post-translational modifications, and downstream applications .

What are the optimal conditions for expressing and purifying functional Dictyostelium discoideum derlin-1 homolog?

The optimal conditions for expressing and purifying functional Dictyostelium discoideum derlin-1 homolog vary significantly depending on the expression system selected. For E. coli-based expression (CSB-CF709711DKK), induction temperatures between 16-25°C typically yield better results than standard 37°C induction, reducing inclusion body formation for this membrane protein . When purifying derlin-1 homolog, a dual approach is recommended: initial solubilization using mild detergents such as n-dodecyl-β-D-maltoside (DDM) at 0.5-1% concentration, followed by purification via immobilized metal affinity chromatography (IMAC) and size exclusion chromatography .

For functional studies, reconstitution into proteoliposomes may be necessary to maintain native activity. Lipid composition significantly affects functionality, with a mixture resembling ER membranes (PC:PE:PI:PS:cholesterol at 5:2:1:1:1) showing optimal results for maintaining channel activity . Proper folding should be verified through circular dichroism spectroscopy before proceeding to functional assays.

How can researchers effectively investigate protein-protein interactions involving derlin-1 homolog in Dictyostelium?

Investigating protein-protein interactions involving derlin-1 homolog in Dictyostelium requires specialized techniques addressing the challenges of membrane protein complex analysis. Co-immunoprecipitation experiments similar to those performed with DetA and RepE in Dictyostelium can be adapted for derlin-1 homolog studies . To implement this approach effectively, researchers should:

  • Generate GFP-tagged or epitope-tagged (e.g., 3×HA) derlin-1 homolog constructs for expression in Dictyostelium

  • Use cross-linking agents (DSP or formaldehyde at 0.1-1%) to stabilize transient interactions before cell lysis

  • Perform immunoprecipitation using GFP-Trap beads or anti-epitope antibodies

  • Analyze the precipitated complexes via Western blotting or mass spectrometry

Based on knowledge from other systems, potential interaction partners to investigate include Dictyostelium homologs of components in the ERAD machinery, particularly VCP/p97, E3 ubiquitin ligases, and other derlin family members . The successful detection of RepE interaction with DetA in Dictyostelium suggests similar methodologies could be effective for derlin-1 homolog interaction studies .

What experimental approaches can be used to study the channel activity of recombinant derlin-1 homolog?

Several experimental approaches can be employed to study the putative channel activity of recombinant derlin-1 homolog from Dictyostelium discoideum:

  • Planar Lipid Bilayer Electrophysiology: Purified recombinant derlin-1 homolog can be reconstituted into planar lipid bilayers, allowing direct measurement of channel conductance, ion selectivity, and voltage dependence. This method provides detailed information about channel properties but requires highly purified and correctly folded protein.

  • Liposome Dye Release Assays: Liposomes loaded with fluorescent dyes can be used to assess the pore-forming activity of reconstituted derlin-1 homolog. The release of encapsulated dyes indicates channel formation or membrane permeabilization.

  • FRET-based Retrotranslocation Assays: Fluorescently labeled model substrates can be used to monitor the retrotranslocation activity of derlin-1 homolog in reconstituted proteoliposomes or semi-permeabilized cells.

  • Single-Molecule Fluorescence Microscopy: This technique allows visualization of individual channel complexes and their dynamics in membrane environments, providing insights into assembly and substrate interaction.

These approaches should be coupled with mutagenesis studies targeting conserved residues to identify critical amino acids involved in channel formation and substrate recognition .

How should researchers design experiments to compare the function of derlin-1 homolog across different species?

When designing comparative studies of derlin-1 homolog function across species, researchers should implement a multi-faceted approach that accounts for evolutionary differences while focusing on conserved mechanisms:

  • Complementation Assays: Express Dictyostelium derlin-1 homolog in derlin-1 deficient systems from other species (yeast, mammalian cells) to assess functional conservation. Quantify rescue efficiency using established ERAD substrate degradation assays.

  • Domain Swap Experiments: Create chimeric proteins by exchanging functional domains between Dictyostelium and human derlin-1, then assess their functionality in respective native systems to identify species-specific differences in domain function.

  • Comparative Proteomics: Perform immunoprecipitation followed by mass spectrometry to identify interaction partners in different species, establishing conservation and divergence in the interactome networks.

  • Evolutionary Analysis: Conduct phylogenetic analyses of derlin family proteins to establish evolutionary relationships and identify conserved functional motifs across species from Dictyostelium to humans .

  • Structural Comparison: Use cryo-EM or computational modeling to compare structural features across species, with particular attention to transmembrane regions and interaction interfaces.

This approach provides a comprehensive understanding of both conserved functions and species-specific adaptations in derlin-1 biology .

What techniques are most effective for analyzing the role of derlin-1 homolog in Dictyostelium development?

Analyzing the role of derlin-1 homolog in Dictyostelium development requires techniques that can connect molecular function to developmental outcomes:

  • CRISPR/Cas9 Gene Editing: Generate precise knock-out or knock-in mutations in the endogenous derlin-1 homolog gene to assess its developmental functions. This approach is preferable to RNAi for complete elimination of gene function.

  • Developmental Phenotyping: Carefully assess developmental progression using time-lapse microscopy to monitor aggregation, mound formation, slug migration, and fruiting body formation in wild-type versus mutant strains. Similar approaches revealed developmental defects in DetA mutants with enlarged aggregation territories and delayed development .

  • Cell-Type Specific Markers: Employ cell-type specific markers and reporters to assess potential alterations in cell differentiation patterns, as was observed with prestalk/prespore patterning in DetA mutants .

  • ER Stress Assays: Monitor ER stress markers in developing structures to connect derlin-1 homolog function with developmental progression, particularly during transitions between developmental stages.

  • Transcriptomics: Perform RNA-seq at different developmental timepoints to identify genes differentially expressed in derlin-1 homolog mutants compared to wild-type, revealing affected pathways.

  • Rescue Experiments: Complement mutant phenotypes with wild-type or mutant variants of derlin-1 homolog to map structure-function relationships in the developmental context .

What are the best approaches for studying the interaction between derlin-1 homolog and the proteasome in Dictyostelium?

Studying the interaction between derlin-1 homolog and the proteasome in Dictyostelium requires specialized approaches addressing both physical interactions and functional coupling:

  • Proximity Labeling Proteomics: Employ BioID or APEX2 fusions with derlin-1 homolog to identify nearby proteins in living cells, capturing even transient interactions with proteasome components that might be missed by traditional co-immunoprecipitation.

  • Fluorescence Microscopy: Utilize dual-color fluorescence microscopy with tagged derlin-1 homolog and proteasome subunits to assess co-localization in living Dictyostelium cells, particularly under conditions of induced ER stress.

  • Proteasome Activity Assays: Measure proteasome activity in wild-type versus derlin-1 homolog mutant cells using fluorogenic substrates, assessing whether derlin-1 influences proteasome function.

  • Ubiquitination Profiling: Compare the ubiquitination profiles of ER proteins in wild-type versus derlin-1 homolog mutant cells to establish functional connections between derlin-1-mediated retrotranslocation and proteasomal degradation.

  • Cycloheximide Chase Experiments: Track the degradation kinetics of known ERAD substrates in the presence or absence of derlin-1 homolog and with proteasome inhibitors to delineate the contribution of each component to protein turnover.

  • Chemical Crosslinking Mass Spectrometry: Use crosslinking agents followed by mass spectrometry to map specific interaction interfaces between derlin-1 homolog and proteasome components .

How can researchers overcome expression challenges when producing recombinant derlin-1 homolog?

Researchers facing expression challenges with recombinant derlin-1 homolog from Dictyostelium discoideum can implement several strategies to improve yields and protein quality:

  • Codon Optimization: For expression in heterologous systems, adapt the coding sequence to the codon bias of the host organism (E. coli, yeast, etc.) while maintaining the amino acid sequence.

  • Fusion Tags Selection: Test multiple fusion tags beyond standard His6, including MBP, SUMO, or Trx, which can enhance solubility of membrane proteins like derlin-1 homolog.

  • Expression Temperature Modulation: Reduce expression temperature to 16-20°C and extend induction time to favor proper folding over rapid accumulation, particularly crucial for membrane proteins.

  • Specialized Host Strains: Utilize E. coli strains specifically designed for membrane protein expression (C41(DE3), C43(DE3)) or those with enhanced disulfide bond formation capability (SHuffle).

  • Detergent Screening: When extracting expressed protein, systematically screen multiple detergents (DDM, LMNG, GDN) at various concentrations to optimize solubilization without denaturation.

  • Truncation Constructs: Design systematic truncation variants to identify minimal functional domains that express more readily than the full-length protein .

The choice between different expression systems (bacterial, yeast, baculovirus, mammalian) should be guided by the specific experimental requirements and the challenges encountered with each system .

What are common pitfalls in functional assays for derlin-1 homolog and how can they be addressed?

Common pitfalls in functional assays for derlin-1 homolog include:

  • Protein Aggregation: Derlin-1 homolog, as a multi-pass membrane protein, is prone to aggregation during purification and reconstitution. Solution: Maintain critical micelle concentration (CMC) of detergents throughout all steps and validate protein monodispersity by dynamic light scattering before functional assays.

  • Incomplete Reconstitution: Poor incorporation into liposomes or proteoliposomes leads to inconsistent results. Solution: Verify protein orientation and incorporation efficiency using protease protection assays and freeze-fracture electron microscopy.

  • Non-specific Effects in Cell-Based Assays: Overexpression of derlin-1 homolog can cause ER stress, confounding interpretation of phenotypes. Solution: Use inducible expression systems and carefully titrate expression levels, including Western blot quantification against endogenous protein.

  • Substrate Specificity Issues: Using non-native substrates may yield artificial results. Solution: Identify and validate endogenous Dictyostelium ERAD substrates for functional studies, rather than relying solely on heterologous substrates.

  • Interference from Endogenous Proteins: Endogenous derlin-1 homolog can compensate for mutant phenotypes. Solution: Use CRISPR/Cas9 to generate complete knockouts rather than relying on RNAi knockdown approaches.

  • Buffer Composition Effects: Channel activity is highly sensitive to buffer conditions. Solution: Systematically test multiple buffer compositions, paying particular attention to pH, ionic strength, and divalent cation concentrations .

How should researchers interpret contradictory data from different derlin-1 homolog expression systems?

When faced with contradictory data from different expression systems for derlin-1 homolog, researchers should employ a systematic analytical approach:

  • Protein Conformation Analysis: Compare secondary and tertiary structure across expression systems using circular dichroism, limited proteolysis, and thermal stability assays to determine which system produces properly folded protein.

  • Post-translational Modification Profiling: Analyze proteins from different expression systems using mass spectrometry to identify systems-specific modifications that might affect function.

  • Functional Benchmarking: Establish a core functional assay (e.g., interaction with a known binding partner) to benchmark proteins from different systems against a defined standard.

  • Native System Validation: When possible, compare results to the native Dictyostelium protein to determine which recombinant system most faithfully recapitulates natural function.

  • Complementation Testing: Test the ability of protein from each expression system to rescue derlin-1 deficient cells as a definitive functional comparison.

  • Systematic Literature Review: Conduct a comprehensive review of related proteins, noting patterns of expression system-specific artifacts reported by other researchers.

  • Contextual Interpretation: Consider that different experimental questions may be better addressed by protein from different expression systems - structural studies may benefit from E. coli expression while interaction studies may require mammalian expression .

How can researchers design experiments to study the role of derlin-1 homolog in ER stress responses in Dictyostelium?

To study the role of derlin-1 homolog in ER stress responses in Dictyostelium, researchers should implement a multi-faceted experimental design:

  • Stress Induction Protocol: Establish a standardized ER stress induction protocol using tunicamycin (1-5 μg/ml), thapsigargin (0.1-1 μM), or DTT (1-5 mM) with optimized concentrations and treatment durations specific for Dictyostelium.

  • Gene Expression Analysis: Measure changes in derlin-1 homolog expression under ER stress conditions using RT-qPCR and Western blotting, compared to canonical ER stress markers in Dictyostelium.

  • CRISPR/Cas9 Mutant Generation: Create derlin-1 homolog knockout and overexpression strains using CRISPR/Cas9 or homologous recombination techniques, then assess their sensitivity to ER stressors compared to wild-type cells.

  • Proteostasis Assays: Monitor the degradation kinetics of known ERAD substrates in wild-type versus derlin-1 homolog mutant cells under normal and ER stress conditions.

  • Transcriptome Analysis: Perform RNA-seq comparing wild-type and derlin-1 homolog mutant cells under normal and stress conditions to identify derlin-1-dependent transcriptional responses.

  • Cell Viability and Development: Assess how derlin-1 homolog affects cell survival and developmental progression during chronic and acute ER stress.

  • Interactome Dynamics: Use proximity labeling or co-immunoprecipitation followed by mass spectrometry to identify stress-induced changes in the derlin-1 homolog protein interaction network .

What approaches can be used to study the evolutionary conservation of derlin-1 function between Dictyostelium and higher organisms?

To study the evolutionary conservation of derlin-1 function between Dictyostelium and higher organisms, researchers should employ these complementary approaches:

  • Phylogenetic Analysis: Construct comprehensive phylogenetic trees of derlin family proteins across species, identifying conserved regions and species-specific adaptations using both sequence and structural information.

  • Heterologous Expression: Express human DERL1 in Dictyostelium derlin-1 homolog knockout cells to assess functional complementation, and vice versa with Dictyostelium derlin-1 homolog in human cells.

  • Domain Swap Experiments: Create chimeric proteins containing domains from both human and Dictyostelium derlin-1, then test their functionality in both systems to identify conserved functional domains.

  • Structural Comparison: Generate structural models of both proteins using AlphaFold or similar tools, then compare transmembrane topology, channel features, and interaction interfaces.

  • Comparative Interactomics: Identify interaction partners of derlin-1 in both species through immunoprecipitation-mass spectrometry, then determine the degree of conservation in the interaction networks.

  • Conserved Substrate Testing: Test whether known human DERL1 substrates are recognized by Dictyostelium derlin-1 homolog and vice versa.

  • Response to Conserved Stressors: Compare transcriptional and translational responses to ER stress in both systems, focusing on derlin-1 regulation and function .

How can advanced imaging techniques be applied to study derlin-1 homolog localization and dynamics in living Dictyostelium cells?

Advanced imaging techniques can provide unprecedented insights into derlin-1 homolog behavior in living Dictyostelium cells:

  • CRISPR Knock-in Fluorescent Tagging: Generate endogenously tagged derlin-1 homolog using CRISPR/Cas9 to introduce fluorescent proteins (mNeonGreen or HaloTag) at the native locus, ensuring physiological expression levels.

  • Super-Resolution Microscopy: Apply techniques like STORM, PALM, or SIM to visualize derlin-1 homolog distribution within the ER at nanoscale resolution, potentially revealing functional clusters or microdomains.

  • Fluorescence Recovery After Photobleaching (FRAP): Measure the mobility of derlin-1 homolog within the ER membrane under normal conditions versus ER stress, providing insights into complex formation and oligomerization state.

  • Förster Resonance Energy Transfer (FRET): Use FRET pairs to study interactions between derlin-1 homolog and other ERAD components in living cells, providing spatial and temporal information about complex assembly.

  • Single-Particle Tracking: Track individual derlin-1 homolog molecules using photoactivatable fluorescent proteins or quantum dots to characterize diffusion properties and confinement zones.

  • Lattice Light-Sheet Microscopy: Employ this technique for long-term, high-resolution 4D imaging with minimal phototoxicity to follow derlin-1 homolog dynamics throughout Dictyostelium development.

  • Correlative Light and Electron Microscopy (CLEM): Combine fluorescence imaging of tagged derlin-1 homolog with electron microscopy to correlate protein localization with ultrastructural features of the ER .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.