Recombinant Dictyostelium discoideum Probable methylene-fatty-acyl-phospholipid synthase (pem2)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Dictyostelium discoideum Probable methylene-fatty-acyl-phospholipid synthase (Pem2) is a genetically engineered enzyme derived from the social amoeba D. discoideum. This protein plays a critical role in phospholipid metabolism, particularly in the synthesis of methylene-fatty-acyl-phospholipids, which are essential components of cellular membranes . As a model organism, D. discoideum provides a tractable system for studying conserved eukaryotic processes, making recombinant Pem2 a valuable tool for biochemical and cell biology research .

Enzymatic Function

Pem2 catalyzes the transfer of methyl groups to phospholipids, a critical step in the biosynthesis of methylated phospholipids. These lipids influence membrane fluidity, signaling, and interactions with other cellular components . In D. discoideum, phospholipid remodeling is tightly linked to developmental processes, such as fruiting body formation and spore maturation . The enzyme’s activity may also intersect with cyclic AMP (cAMP) signaling pathways, which regulate multicellular development in this organism .

Research Applications

Recombinant Pem2 is widely used in:

  • Mechanistic studies of phospholipid biosynthesis and membrane dynamics .

  • High-throughput assays for developmental toxicity testing, leveraging D. discoideum’s genetic tractability .

  • Host-pathogen interaction studies, given the amoeba’s role in phagocytosis and bacterial killing .

Technical Considerations

  • Expression and Purification: Pem2 is produced in heterologous systems (e.g., E. coli or Baculovirus) with tags added during production .

  • Stability: Repeated freeze-thaw cycles are discouraged; working aliquots should be stored at 4°C for short-term use .

  • Functional Assays: Activity is validated via enzymatic assays measuring methyltransferase activity or through phenotypic rescue experiments in D. discoideum mutants .

Key Research Findings

  • Developmental Regulation: Pem2 homologs in D. discoideum are implicated in membrane remodeling during starvation-induced aggregation and fruiting body formation .

  • Evolutionary Conservation: The enzyme’s structural and functional homology to human methyltransferases supports its use in studying lipid-related diseases .

  • Transcriptional Responses: While not directly linked to Pem2, D. discoideum’s transcriptional adaptability to bacterial encounters highlights the broader relevance of lipid metabolism in host-microbe interactions .

Future Directions

Further studies could explore Pem2’s role in:

  • Membrane asymmetry during phagocytosis.

  • Crosstalk between lipid biosynthesis and cAMP signaling in development.

  • Drug discovery targeting lipid metabolism in pathogenic amoebae or human diseases .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are shipped standard with normal blue ice packs. If you require dry ice shipping, please communicate this to us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specified tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
pemtA; DDB_G0282527; Phosphatidylethanolamine N-methyltransferase A; PEAMT; PEMT; Phospholipid methyltransferase A; PLMT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-213
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
pemtA
Target Protein Sequence
MIVEHAIDYIDYLMNYVDFTEKYFLLTIACVVFNPTWWNITARMEYKTKFMTKICGSKEN GCYLLAFLIFSLGILRDWLFSEALIRQPIFQEFDRFEVEVLSYILYGFGGILVLAAYLKL GITGTYLGDYFGILMKERVTGFPFNVMNNPMYNGSVMLFIAHALSYKSVAGLVLSFVVYV VYKFALIFEESFTNYIYSTAAANAAKKNKSKSK
Uniprot No.

Target Background

Function
Catalyzes the three sequential steps of the methylation pathway of phosphatidylcholine biosynthesis, the SAM-dependent methylation of phosphatidylethanolamine (PE) to phosphatidylmonomethylethanolamine (PMME), PMME to phosphatidyldimethylethanolamine (PDME), and PDME to phosphatidylcholine (PC).
Database Links
Protein Families
Class VI-like SAM-binding methyltransferase superfamily, PEMT/PEM2 methyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is Dictyostelium discoideum and why is it used as a model organism?

Dictyostelium discoideum is a social amoeba that has been utilized as a model organism for nearly a century. It serves as an inexpensive and high-throughput model system for studying fundamental cellular and developmental processes. Its popularity stems from several key advantages:

  • It possesses a unique life cycle comprising a unicellular growth phase and a 24-hour multicellular developmental phase with distinct stages that shares commonalities with metazoan development but occurs much more rapidly .

  • The Dictyostelium genome is fully sequenced, with low redundancy (34 MB), providing a less complex system while maintaining many genes and signaling pathways found in more complex eukaryotes .

  • Its haploid genome allows researchers to easily introduce one or multiple gene disruptions, facilitating gene function studies in a multicellular organism with measurable phenotypic outcomes .

  • It supports various expression constructs that enable studies on protein localization and function .

  • Insertional mutant libraries are available that facilitate pharmacogenetic screens to enhance understanding of bioactive compound functions at the cellular level .

What is the probable methylene-fatty-acyl-phospholipid synthase (pem2) and what is its function?

The probable methylene-fatty-acyl-phospholipid synthase (pem2), also known as pemtA or phospholipid methyltransferase family protein, is an enzyme (EC 2.1.1.16) from Dictyostelium discoideum . Based on its classification:

  • It belongs to the phospholipid methyltransferase family .

  • It likely functions in the methylation of fatty acyl phospholipids, which is critical for membrane structure and function.

  • The protein has orthologues in other organisms, including the OPI3/PEM2 gene in Saccharomyces cerevisiae, which functions as a bifunctional phosphatidyl-N-methylethanolamine N-methyltransferase/phosphatidyl-N-dimethylethanolamine N-methyltransferase .

While the exact function in Dictyostelium is not fully characterized in the provided sources, its homology to similar enzymes in other organisms suggests involvement in phospholipid metabolism and membrane biogenesis.

What expression systems are available for recombinant pem2 production?

The recombinant Dictyostelium discoideum methylene-fatty-acyl-phospholipid synthase (pem2) can be produced using several expression systems, each with distinct advantages for different research applications:

Expression SystemAdvantagesPotential Applications
Cell-Free ExpressionRapid production, avoids cellular toxicity issues, suitable for difficult-to-express proteinsStructural studies, rapid screening
E. coliHigh yield, cost-effective, well-established protocolsBiochemical characterization, antibody production
YeastEukaryotic post-translational modifications, proper protein foldingFunctional studies requiring correct modifications
BaculovirusHigh-level expression of complex proteins, eukaryotic processingLarge-scale production, proteins requiring complex folding
Mammalian CellAuthentic post-translational modifications, proper folding of complex proteinsStudies requiring mammalian-like modifications, interaction studies

Based on the search results, recombinant pem2 has been successfully expressed in cell-free systems as well as E. coli, yeast, baculovirus, and mammalian cell systems . The choice of expression system should be guided by the specific research requirements and downstream applications.

What are the recommended methods for purifying recombinant pem2?

Although the specific purification protocols are not detailed in the provided search results, standard methods for recombinant protein purification can be applied to pem2, with considerations for its specific properties:

  • Affinity Chromatography: If expressed with an affinity tag (common in recombinant systems), use the appropriate affinity resin (His-tag, GST-tag, etc.).

  • Ion Exchange Chromatography: Based on the protein's isoelectric point, which can be calculated from its amino acid sequence.

  • Size Exclusion Chromatography: For final polishing and buffer exchange.

The target purity for research applications is typically ≥85% as determined by SDS-PAGE , which should be verified using appropriate analytical methods.

How should recombinant pem2 be stored to maintain stability and activity?

For optimal stability and activity, the following storage conditions are recommended:

  • Long-term Storage: At -20°C or -80°C in the presence of glycerol (typically 50% final concentration) .

  • Working Aliquots: Store at 4°C for up to one week to avoid repeated freeze-thaw cycles .

  • Reconstitution: If provided in lyophilized form, reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Shelf Life: Generally, the shelf life is 6 months for liquid form at -20°C/-80°C and 12 months for lyophilized form at -20°C/-80°C .

Repeated freezing and thawing should be avoided as it can lead to protein denaturation and loss of activity .

How can pem2 be utilized in phospholipid metabolism research?

As a probable methylene-fatty-acyl-phospholipid synthase, pem2 can serve as a valuable tool in phospholipid metabolism research:

  • Enzyme Kinetics Studies: Characterizing the catalytic parameters (Km, Vmax, substrate specificity) of the enzyme to understand its role in phospholipid methylation pathways.

  • Membrane Biogenesis Research: Investigating how phospholipid methylation affects membrane structure, fluidity, and function in Dictyostelium and potentially other organisms.

  • Comparative Biochemistry: Studying evolutionary conservation of phospholipid methyltransferases by comparing pem2 with homologous enzymes from other organisms, such as the OPI3/PEM2 from Saccharomyces cerevisiae .

  • Developmental Biology: Examining how phospholipid composition changes during the transition from unicellular to multicellular stages in Dictyostelium development, potentially using pem2 as a marker or tool.

What role does Dictyostelium discoideum play in developmental and toxicological research?

Dictyostelium discoideum has emerged as a valuable model organism for developmental and toxicological research:

  • Developmental Studies: The organism transitions from a unicellular to multicellular form during its life cycle, making it useful for studying developmental processes in a simplified system .

  • Toxicological Screening:

    • Dictyostelium can be used for high-throughput screening of chemical compounds for developmental toxicity .

    • It serves as a non-animal alternative model in developmental and reproductive toxicity (DART) testing .

    • Research has shown significant relationships between toxicity values in Dictyostelium and mammalian systems, indicating its utility as a predictive model .

  • Genetic Characterization of Toxicants: The organism can be used to genetically characterize developmentally toxic compounds through next-generation functional genomic screens .

  • Biomedical Applications: Research using Dictyostelium has biomedical relevance in areas such as host-pathogen interactions, protein homeostasis, and understanding processes dysregulated in human diseases .

How can CRISPR-Cas9 or other gene editing technologies be used to study pem2 function in Dictyostelium?

Advanced gene editing approaches can be particularly valuable for studying pem2 function:

  • Gene Knockout Studies:

    • Dictyostelium's haploid genome makes it particularly amenable to knockout approaches .

    • CRISPR-Cas9 can be used to create precise deletions or modifications in the pem2 gene.

    • Phenotypic analysis of knockout strains can reveal the functional consequences of pem2 deletion on cell growth, development, and phospholipid composition.

  • Domain Mutation Analysis:

    • Targeted mutations in specific functional domains of pem2 can help identify critical residues for catalytic activity or substrate binding.

    • This approach can distinguish between different functions if the protein has multiple roles.

  • Tagging for Localization Studies:

    • Endogenous tagging of pem2 with fluorescent proteins can reveal its subcellular localization and dynamics during different cellular processes and developmental stages.

    • This can provide insights into the spatial regulation of phospholipid metabolism.

  • Promoter Analysis:

    • Modifications to the endogenous promoter can help understand transcriptional regulation of pem2 during development or in response to environmental stimuli.

What are the challenges in characterizing enzymatic activity of recombinant pem2?

Researchers face several challenges when characterizing the enzymatic activity of recombinant pem2:

  • Substrate Specificity Determination:

    • Identifying the physiological substrates requires testing various phospholipid species.

    • Developing sensitive assays to detect methylated phospholipid products can be technically challenging.

  • Membrane Association:

    • As a probable membrane-associated enzyme, reconstituting proper activity in vitro may require appropriate membrane mimetics (liposomes, nanodiscs, detergent micelles).

    • The hydrophobic nature of substrates and products presents challenges for solubility and detection.

  • Co-factors and Regulatory Partners:

    • Identifying potential co-factors (e.g., metal ions, SAM) and regulatory proteins that may modulate pem2 activity in vivo.

    • Reconstituting these interactions in vitro for accurate activity assessment.

  • Distinguishing from Related Activities:

    • Ensuring that observed methyltransferase activity is specifically attributable to pem2 rather than contaminating enzymes, particularly when expression systems contain endogenous methyltransferases.

How can comparative genomic approaches enhance our understanding of pem2 function?

Comparative genomic approaches offer powerful insights into pem2 function:

  • Ortholog Identification and Analysis:

    • Identifying pem2 orthologs across various species can reveal evolutionarily conserved features and species-specific adaptations.

    • Comparison with well-characterized enzymes like OPI3/PEM2 from Saccharomyces cerevisiae can provide functional insights .

  • Domain Conservation Analysis:

    • Comparative analysis of functional domains can identify critical regions for catalytic activity or substrate recognition.

    • This information can guide site-directed mutagenesis experiments to confirm functional predictions.

  • Expression Pattern Comparison:

    • Comparing expression patterns of pem2 orthologs across species can reveal conserved regulatory mechanisms.

    • This may highlight conserved developmental or stress-responsive roles.

  • Interactome Mapping:

    • Cross-species comparison of protein-protein interaction networks can identify conserved functional complexes involving pem2 and related enzymes.

    • This can place pem2 in broader metabolic and signaling networks.

  • Leveraging Multiple Dictyostelium Genomes:

    • With multiple Dictyostelid genome sequences now available, comparative analysis within this group can provide insights into functional evolution .

    • This can help understand how diverse developmental forms evolved in Dictyostelids.

What are common issues encountered when working with recombinant pem2 and how can they be addressed?

Researchers working with recombinant pem2 may encounter several common challenges:

  • Low Expression Yields:

    • Problem: Insufficient protein production in the chosen expression system.

    • Solutions:

      • Optimize codon usage for the expression host

      • Test different promoters or induction conditions

      • Consider alternative expression systems (from the options: Cell-Free, E. coli, Yeast, Baculovirus, or Mammalian)

      • Evaluate expression as a fusion protein with solubility-enhancing tags

  • Protein Insolubility:

    • Problem: Formation of inclusion bodies or aggregation.

    • Solutions:

      • Lower expression temperature

      • Co-express with chaperones

      • Use detergents or lipid environments for stabilization

      • Consider refolding protocols if necessary

  • Loss of Activity During Purification:

    • Problem: Enzyme loses activity during purification steps.

    • Solutions:

      • Include stabilizing agents (glycerol, reducing agents) in buffers

      • Minimize purification steps

      • Maintain appropriate pH and ionic strength

      • Avoid harsh elution conditions

  • Storage Stability Issues:

    • Problem: Activity loss during storage.

    • Solutions:

      • Store with 50% glycerol at -20°C or -80°C

      • Prepare small working aliquots to avoid freeze-thaw cycles

      • Consider lyophilization for long-term storage

How can enzymatic assays for pem2 activity be optimized?

Optimizing enzymatic assays for pem2 requires careful consideration of several factors:

  • Substrate Preparation:

    • Ensure proper solubilization of phospholipid substrates using appropriate detergents or lipid vesicles

    • Maintain consistent substrate quality and concentration across experiments

  • Assay Conditions Optimization:

    • Systematically test different buffer compositions, pH values, and ionic strengths

    • Evaluate the effect of potential cofactors (e.g., S-adenosylmethionine as methyl donor)

    • Determine optimal temperature and incubation times

  • Product Detection Methods:

    • Consider multiple detection approaches:

      • Radiometric assays using labeled methyl donors

      • Mass spectrometry-based approaches for direct product identification

      • Coupled enzyme assays that link product formation to a detectable signal

      • Chromatographic separation and quantification of methylated phospholipids

  • Data Analysis and Validation:

    • Include appropriate controls (heat-inactivated enzyme, no substrate, no enzyme)

    • Ensure linearity of the assay within the experimental time frame

    • Validate with known inhibitors if available

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.