Recombinant Dictyostelium discoideum Probable microsomal glutathione S-transferase (mgst)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
mgst; DDB_G0290291; Probable microsomal glutathione S-transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-149
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
mgst
Target Protein Sequence
MPFDTKSIFPDFIVFPSAISTIAIGLWSVQAYKLGEARKRYNVKAPHVQGDPEFERIAHE YQNTSEALGAIIPATFMFSYYISPKCSLLLGGTWLVSKMLNCCSYCCKKEKENDCAKNVH TCLSHISFFALLGGSAFGIGSSLYNRYKL
Uniprot No.

Target Background

Function
This protein may catalyze the conjugation of reduced glutathione to electrophiles.
Database Links
Protein Families
MAPEG family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of recombinant D. discoideum mgst protein?

The recombinant full-length Dictyostelium discoideum microsomal glutathione S-transferase (mgst) protein consists of 149 amino acids with an N-terminal His-tag. The complete amino acid sequence is: MPFDTKSIFPDFIVFPSAISTIAIGLWSVQAYKLGEARKRYNVKAPHVQGDPEFERIAHEYQNTSEALGAIIPATFMFSYYISPKCSLLLGGTWLVSKMLNCCSYCCKKEKENDCAKNVHTCLSHISFFALLGGSAFGIGSSLYNRYKL. The protein has a UniProt ID of Q54GA9 and is encoded by the gene DDB_G0290291 . The recombinant protein is typically expressed in E. coli expression systems for research purposes, maintaining the functional domains required for glutathione binding and substrate catalysis.

How does D. discoideum mgst differ from other GST family members in this organism?

D. discoideum expresses multiple glutathione S-transferase enzymes, with five identified alpha class isozymes (GSTA1-GSTA5). Unlike these alpha class GSTs, which are predominantly cytosolic, the mgst protein is a microsomal GST that associates with membranes. While alpha class GSTs like GSTA2 and GSTA3 show significant expression changes during starvation and development, with marked reductions of up to 96% and 86.6% respectively under starvation conditions , the expression pattern of mgst likely follows a different regulatory pattern due to its distinct cellular localization and function. Alpha class GSTs contain an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain that form the co-substrate binding site (H-site) , while mgst has a different structural organization reflecting its membrane association.

What are the optimal storage conditions for maintaining recombinant D. discoideum mgst activity?

For optimal activity preservation, recombinant D. discoideum mgst protein should be stored as a lyophilized powder at -20°C/-80°C upon receipt. After reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL, the addition of 5-50% glycerol (with 50% being recommended) helps maintain stability during storage at -20°C/-80°C. For working stocks, aliquots can be stored at 4°C for up to one week, but repeated freeze-thaw cycles should be strictly avoided as they significantly compromise enzyme activity . Before opening the vial, brief centrifugation is recommended to bring contents to the bottom. The reconstituted protein is typically stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

What expression system yields the highest functional activity for recombinant D. discoideum mgst?

The E. coli expression system has been demonstrated to produce high yields of functional recombinant D. discoideum mgst protein with greater than 90% purity as determined by SDS-PAGE . While E. coli is the standard system, researchers investigating the functional properties of this enzyme should consider that post-translational modifications may differ from the native protein. For studies requiring post-translational modifications similar to the eukaryotic cellular environment, expression in yeast systems like Pichia pastoris might yield protein with activity profiles more closely resembling the native enzyme. Expression protocols should be optimized for temperature, IPTG concentration, and induction time to balance between protein yield and proper folding, as improper folding can significantly affect the catalytic activity of GST enzymes.

What purification strategy provides the highest yield of active D. discoideum mgst?

A multi-step purification strategy is recommended for obtaining high-purity, active recombinant D. discoideum mgst. The initial purification typically utilizes the N-terminal His-tag with immobilized metal affinity chromatography (IMAC) . For enhanced purity, this should be followed by size exclusion chromatography to separate the target protein from aggregates and degradation products. Researchers can also implement glutathione affinity chromatography as used for other D. discoideum GST enzymes , which has the added advantage of selecting for functionally active enzyme molecules that can bind glutathione. Purification buffers should typically contain reducing agents (like DTT or β-mercaptoethanol) to prevent oxidation of critical cysteine residues that may affect enzyme activity. Optimization of the elution conditions is crucial, with imidazole gradients for His-tag purification and reduced glutathione for GSH-affinity methods.

How can researchers verify the functional integrity of purified recombinant D. discoideum mgst?

Verification of functional integrity requires a combination of analytical approaches. Primary assessment should include enzymatic activity assays using CDNB (1-chloro-2,4-dinitrobenzene), which is a standard substrate for GST activity measurement . The specific activity (μmol/min/mg protein) should be calculated and compared to reference values. Secondary verification includes circular dichroism (CD) spectroscopy to confirm proper protein folding and thermal shift assays to assess protein stability. Additionally, size exclusion chromatography can detect protein aggregation that would compromise activity. For more detailed structural verification, limited proteolysis followed by mass spectrometry can confirm that the protein maintains its native conformational state. The integration of these methods provides comprehensive validation of the recombinant protein's functional integrity before proceeding with experimental applications.

What is the optimal assay method for measuring D. discoideum mgst enzymatic activity?

The standard and most reliable method for measuring D. discoideum mgst enzymatic activity is the CDNB (1-chloro-2,4-dinitrobenzene) conjugation assay. This spectrophotometric method measures the increase in absorbance at 340 nm resulting from the formation of the glutathione-CDNB conjugate . The reaction mixture typically contains GSH (usually 1-5 mM), CDNB (0.5-2 mM), and buffer (usually potassium phosphate, pH 6.5-7.0). For microsomal GSTs like mgst, the addition of a non-ionic detergent such as Triton X-100 at low concentrations (0.1-0.5%) may be necessary to solubilize the enzyme while maintaining activity. The kinetic parameters (Km, Vmax, kcat) should be determined under varying substrate concentrations following Michaelis-Menten kinetics. Alternative substrates such as DCNB (1,2-dichloro-4-nitrobenzene) or cumene hydroperoxide can also be used to characterize the substrate specificity profile of the enzyme.

How do experimental conditions affect the catalytic activity of recombinant D. discoideum mgst?

The catalytic activity of recombinant D. discoideum mgst is significantly influenced by several experimental parameters. The pH optimum for most GST enzymes, including microsomal GSTs, typically ranges between 6.5-7.5, with activity decreasing sharply outside this range. Temperature also critically affects activity, with most enzymatic assays conducted at 25-30°C. Higher temperatures can initially increase reaction rates but may lead to protein denaturation over time. The presence of divalent cations (e.g., Mg²⁺, Ca²⁺) can modulate activity, either enhancing or inhibiting depending on concentration. Reducing agents like DTT or β-mercaptoethanol at low concentrations (1-5 mM) can prevent oxidation of catalytic cysteine residues, maintaining optimal activity. Studies with other D. discoideum GSTs have shown that environmental stressors significantly affect activity, with starvation conditions reducing GST activity by approximately 60% , suggesting that recombinant mgst activity may also be sensitive to experimental stress conditions.

What are the kinetic parameters of recombinant D. discoideum mgst compared to other GST isoforms?

While specific kinetic parameters for recombinant D. discoideum mgst have not been directly reported in the provided search results, comparative analysis can be drawn with other characterized D. discoideum GST isoforms. Studies with recombinant DdGSTA2 and DdGSTA3 showed distinct kinetic properties, with DdGSTA2 demonstrating higher activity toward the CDNB substrate . For comprehensive kinetic characterization, researchers should determine:

  • Km values for both GSH and electrophilic substrates

  • Vmax and kcat values to assess catalytic efficiency

  • Substrate specificity profiles using multiple substrates

  • Inhibition constants (Ki) with known GST inhibitors

The microsomal localization of mgst suggests it may have distinct substrate preferences compared to cytosolic GSTs, potentially showing higher activity toward lipophilic substrates or membrane-associated xenobiotics. A thorough comparative analysis would require side-by-side testing under identical conditions, as kinetic parameters can vary significantly with experimental conditions.

What role does mgst play in D. discoideum development and differentiation?

While the specific role of mgst in D. discoideum development has not been fully characterized, insights can be drawn from studies of other GST enzymes in this organism. GST enzymes in D. discoideum show significant expression changes during developmental transitions, with alpha class GSTs exhibiting marked reductions during starvation-induced development . RNAi-mediated knockdown of DdGSTA2 resulted in a 60% reduction in proliferation, delayed development, and altered morphogenesis of fruiting bodies , suggesting critical roles for GST enzymes in normal development. As a microsomal GST, mgst likely contributes to membrane protection against oxidative stress during developmental transitions and may participate in the metabolism of endogenous signaling molecules that regulate development. The discovery that certain GST isozymes in D. discoideum may bind to differentiation inducing factor (DIF-1) to regulate development suggests that mgst might similarly interact with developmental signaling pathways, potentially through both enzymatic and non-enzymatic functions.

How does mgst contribute to xenobiotic metabolism and cellular detoxification in D. discoideum?

As a member of the glutathione S-transferase family, D. discoideum mgst likely plays a crucial role in phase II biotransformation of xenobiotics. Located in the microsomal fraction, mgst is strategically positioned to detoxify lipophilic compounds that interact with membranes. The enzyme catalyzes the conjugation of glutathione (GSH) to electrophilic centers in xenobiotic compounds, increasing their water solubility and facilitating excretion. Research with other organisms has shown that microsomal GSTs are particularly important for detoxifying products of lipid peroxidation. In D. discoideum, the coordinate action of phase I (CYP450) and phase II (GST) biotransformation during cellular development and differentiation is not fully understood, but studies have shown that CYP450 oxidoreductase null mutants exhibit stunted development and morphogenesis . This finding highlights the importance of detoxification systems in normal development, suggesting that mgst likely contributes to both xenobiotic metabolism and the processing of endogenous compounds that influence developmental processes.

How can recombinant D. discoideum mgst be used as a tool for studying xenobiotic metabolism?

Recombinant D. discoideum mgst serves as an excellent model system for studying xenobiotic metabolism in eukaryotes. Researchers can employ the purified enzyme in substrate screening assays to identify compounds metabolized by this GST. This approach involves incubating the enzyme with potential substrates and analyzing GSH conjugate formation using HPLC, LC-MS/MS, or other analytical techniques. The data generated can provide insights into substrate specificity determinants and help predict xenobiotic metabolism patterns. Additionally, recombinant mgst can be used in comparative metabolism studies with human microsomal GSTs to identify conserved detoxification mechanisms and evolutionary adaptations. For structure-activity relationship studies, researchers can create site-directed mutants of the recombinant protein to identify key residues involved in substrate binding and catalysis. Such studies could reveal how structural features contribute to substrate specificity and catalytic efficiency, potentially informing the design of selective inhibitors or substrates for biotechnological applications.

What approaches can be used to study the regulation of mgst expression in D. discoideum?

Several complementary approaches can be employed to study the regulation of mgst expression in D. discoideum:

  • Real-time PCR: Similar to methods used for other gst genes in D. discoideum, quantitative PCR can track transcriptional changes under various conditions, using primers specific to the mgst gene . The comparative CT method with appropriate housekeeping genes (such as rnlA) provides reliable quantification.

  • Reporter Gene Assays: Constructing reporter plasmids containing the mgst promoter region fused to reporter genes (like GFP or luciferase) allows visualization and quantification of expression regulation in living cells.

  • Chromatin Immunoprecipitation (ChIP): This technique identifies transcription factors and regulatory proteins that bind to the mgst promoter under different conditions.

  • Western Blotting: Using antibodies against the mgst protein to quantify protein levels provides insights into post-transcriptional regulation mechanisms.

  • RNAi or CRISPR-Cas9 Approaches: Similar to techniques used for other GST genes , these methods can disrupt potential regulatory factors to assess their impact on mgst expression.

These approaches should be applied under various conditions, including vegetative growth, development stages, oxidative stress, and exposure to xenobiotics, to comprehensively understand mgst regulation patterns.

How can structural studies of D. discoideum mgst inform drug development and enzyme engineering?

Structural studies of D. discoideum mgst can significantly advance both drug development and enzyme engineering efforts through several approaches:

  • X-ray Crystallography or Cryo-EM: Determining the three-dimensional structure of mgst at high resolution reveals binding pocket architecture, catalytic residues, and conformational states. This provides essential information for structure-based drug design targeting similar enzymes in pathogens or humans.

  • Molecular Dynamics Simulations: These computational methods can model substrate binding, conformational changes during catalysis, and predict how mutations might affect function, guiding rational enzyme engineering.

  • Structure-Activity Relationship (SAR) Studies: Systematic structural variations of substrates and inhibitors, correlated with activity data, identify key molecular features required for binding and catalysis.

  • Protein Engineering: Using the structural information, researchers can design mutations to enhance catalytic efficiency, alter substrate specificity, or improve stability for biotechnological applications.

  • Comparative Structural Analysis: Analyzing structural similarities and differences between D. discoideum mgst and human GSTs can identify potential selective inhibitors that target pathogen enzymes while sparing human counterparts.

These structural insights can lead to the development of selective inhibitors for therapeutic applications or engineered enzymes for bioremediation and industrial catalysis.

What are common challenges in expressing and purifying functional recombinant D. discoideum mgst, and how can they be addressed?

Expression and purification of functional recombinant D. discoideum mgst presents several challenges that researchers should anticipate:

  • Protein Solubility Issues: As a membrane-associated protein, mgst may form inclusion bodies in E. coli. This can be addressed by:

    • Optimizing expression temperature (typically lowering to 16-20°C)

    • Using solubility-enhancing fusion tags beyond the His-tag

    • Including mild detergents (0.1-0.5% Triton X-100) in lysis and purification buffers

    • Exploring specialized E. coli strains designed for membrane protein expression

  • Maintaining Enzymatic Activity: Activity loss during purification is common and can be mitigated by:

    • Including reducing agents (1-5 mM DTT or β-mercaptoethanol) in all buffers

    • Adding glycerol (10-20%) to stabilize the protein

    • Keeping the protein at 4°C throughout purification

    • Minimizing exposure to oxidizing conditions

  • Protein Aggregation: Prevent aggregation by:

    • Including appropriate detergents in a concentration range that solubilizes but doesn't denature

    • Performing size exclusion chromatography as a final purification step

    • Avoiding freeze-thaw cycles by storing in single-use aliquots

  • Endotoxin Contamination: For cellular assays, endotoxin removal using specialized columns may be necessary after initial purification steps.

How can researchers accurately interpret conflicting data on mgst activity across different experimental systems?

When faced with conflicting data on mgst activity across different experimental systems, researchers should implement a systematic approach to reconciliation:

  • Standardize Assay Conditions: Variations in buffer composition, pH, temperature, and substrate concentrations significantly impact enzyme kinetics. Researchers should conduct side-by-side comparisons under identical conditions, particularly noting that GST activity assays for D. discoideum enzymes show condition-dependent variation .

  • Consider Protein Modifications: Expression systems introduce different post-translational modifications. E. coli-expressed proteins lack eukaryotic modifications, potentially affecting activity. Compare activity of the protein expressed in multiple systems (E. coli, yeast, insect cells) to assess this impact.

  • Evaluate Protein Purity and Integrity: Higher purity preparations (>95%) may show different specific activity than lower purity samples. SDS-PAGE, mass spectrometry, and western blotting should confirm protein integrity before comparing activity data.

  • Assess Conformational State: Different purification methods may yield proteins in different conformational states. Circular dichroism spectroscopy and limited proteolysis can verify consistent structural integrity across preparations.

  • Design Experiments to Test Hypotheses: If conflicting data persists, design experiments that specifically test hypotheses about the source of variation, such as examining the effects of specific buffer components or testing activity under varying redox conditions.

  • Apply Multiple Activity Measurement Methods: Beyond the standard CDNB assay, implement alternative substrates and detection methods to provide a more comprehensive activity profile.

What advanced techniques can differentiate between enzymatic and non-enzymatic functions of D. discoideum mgst in cellular processes?

Distinguishing between the enzymatic and non-enzymatic functions of D. discoideum mgst requires sophisticated experimental approaches:

How might comparative studies between D. discoideum mgst and human GSTs inform evolutionary understanding of detoxification systems?

Comparative studies between D. discoideum mgst and human GSTs offer valuable insights into the evolution of detoxification systems across eukaryotes. Researchers should consider several approaches:

  • Phylogenetic Analysis: Constructing comprehensive phylogenetic trees incorporating GSTs from diverse organisms can reveal evolutionary relationships and conserved functional domains. D. discoideum, positioned at a key evolutionary branch point between unicellular and multicellular organisms, provides unique evolutionary context for understanding human GST development.

  • Functional Conservation Testing: Expressing human GSTs in D. discoideum gst knockout strains can determine functional complementarity and conservation of substrate specificity across evolutionary distance. Similar approaches have been informative for other D. discoideum enzymes .

  • Structural Comparison: Overlay analysis of crystal structures between D. discoideum mgst and human counterparts can identify conserved catalytic residues versus species-specific adaptations. This may reveal how environmental pressures shaped detoxification capabilities throughout evolution.

  • Regulatory Mechanism Comparison: Exploring how expression regulation differs between D. discoideum and humans may illuminate the evolution of stress-responsive gene networks. The significant expression changes observed in D. discoideum GSTs during development suggest sophisticated regulatory mechanisms that may have evolutionary parallels in humans.

  • Xenobiotic Metabolism Profiling: Comparing substrate profiles between D. discoideum and human GSTs may reveal core detoxification capacities preserved throughout evolution versus specialized adaptations to specific environmental challenges.

What potential biotechnological applications exist for engineered variants of D. discoideum mgst?

Engineered variants of D. discoideum mgst hold significant potential for diverse biotechnological applications:

  • Bioremediation: Engineered mgst variants with enhanced activity toward environmental pollutants could be immobilized on solid supports or expressed in microbial hosts for bioremediation of contaminated soils and water. The natural detoxification capabilities of GSTs make them ideal candidates for breaking down organic pollutants, herbicides, and industrial waste products.

  • Biosensors: The substrate-binding properties of mgst can be engineered to create highly specific biosensors for environmental toxins, pharmaceuticals, or biological metabolites. These could be coupled with colorimetric or fluorescent outputs for rapid detection systems.

  • Pharmaceutical Manufacturing: Engineered mgst variants could catalyze specific conjugation reactions in pharmaceutical synthesis, particularly for drugs requiring glutathione conjugation. The stereoselectivity of enzymatic reactions offers advantages over chemical synthesis methods.

  • Nanomaterial Functionalization: The ability to bind diverse substrates makes engineered mgst variants useful for functionalizing nanoparticles and creating novel biomaterials with controlled surface properties.

  • Agricultural Applications: Engineered mgst variants could be expressed in crop plants to enhance herbicide detoxification and stress resistance. Alternatively, they could be developed as targeted catalysts for degrading specific agricultural chemicals in the environment.

Achieving these applications requires protein engineering approaches including directed evolution, rational design based on structural information, and computational modeling to predict beneficial mutations.

How might single-cell analysis techniques advance understanding of mgst function in D. discoideum cellular heterogeneity?

Emerging single-cell analysis techniques offer unprecedented opportunities to understand mgst function within the context of D. discoideum cellular heterogeneity:

  • Single-Cell RNA Sequencing (scRNA-seq): This technique can reveal cell-to-cell variations in mgst expression during development and stress responses, potentially identifying specialized subpopulations with distinct detoxification capacities. Given the significant expression changes observed in GST genes during D. discoideum development , scRNA-seq could identify transitional states and expression timing with high precision.

  • Single-Cell Proteomics: Mass spectrometry-based single-cell proteomics can quantify mgst protein levels and post-translational modifications in individual cells, revealing regulatory mechanisms invisible in population averages.

  • Live-Cell Imaging with Activity-Based Probes: Fluorescent probes that bind to active mgst can visualize enzyme activity in living cells with subcellular resolution, potentially revealing microdomains of detoxification activity within the cell.

  • CyTOF (Mass Cytometry): By developing antibodies against mgst and key signaling proteins, researchers can simultaneously measure multiple parameters in thousands of individual cells, correlating mgst expression with cellular phenotypes and developmental states.

  • Spatial Transcriptomics: These techniques preserve spatial information while analyzing gene expression, potentially revealing location-dependent regulation of mgst within multicellular D. discoideum structures during development.

  • Microfluidic Single-Cell Enzyme Assays: Droplet-based microfluidic systems can isolate individual cells to measure mgst activity, correlating enzyme function with specific cellular phenotypes and revealing functional heterogeneity within populations.

These approaches would be particularly valuable for understanding how mgst function contributes to cell fate decisions during the complex developmental processes of D. discoideum .

What strategies are most effective for studying mgst function in D. discoideum developmental processes?

Investigating mgst function in D. discoideum developmental processes requires a multi-faceted approach:

  • Gene Disruption Techniques: CRISPR-Cas9 or RNAi-mediated knockdown systems similar to those used for other D. discoideum GSTs can be employed to specifically target mgst. The established transformation protocols for D. discoideum using electroporation (0.85KV/cm with 5-second intervals) followed by selection with G418 (10 μg/ml) provide reliable methods for generating stable transformants .

  • Developmental Phenotype Analysis: After mgst disruption, researchers should implement standardized developmental assays including:

    • Time-lapse imaging of the complete developmental cycle

    • Quantitative analysis of developmental timing markers

    • Assessment of fruiting body morphology and spore viability

    • Cell-type proportioning analysis using cell-type specific markers

  • Complementation Studies: Reintroducing wild-type or mutant versions of mgst can confirm phenotype specificity and identify functionally important domains or residues.

  • Expression Profiling: Quantitative PCR using the comparative CT method with rnlA as an internal control can track mgst expression throughout development, providing temporal correlation with developmental events.

  • Stress Response Integration: Since GST activity in D. discoideum is significantly regulated by starvation conditions , developmental studies should incorporate controlled stress conditions to assess how mgst function intersects with stress response pathways during development.

  • Cell Mixing Experiments: Combining wild-type and mgst-disrupted cells in various proportions can determine whether the protein functions cell-autonomously or non-cell-autonomously in developmental processes.

How can researchers accurately assess the impact of environmental toxins on D. discoideum mgst activity in vivo?

To accurately assess environmental toxin impacts on D. discoideum mgst activity in vivo, researchers should implement a systematic approach:

  • Biomarker Development: Establish reliable biomarkers for in vivo mgst activity, such as:

    • Specific glutathione conjugates detectable by LC-MS/MS

    • Fluorescent or luminescent reporter systems linked to mgst activity

    • Redox-sensitive probes that reflect mgst-mediated detoxification

  • Dose-Response Studies: Expose D. discoideum cells to increasing concentrations of environmental toxins while monitoring:

    • Cell viability and growth rates

    • mgst transcript and protein levels via qPCR and western blotting

    • Formation of specific glutathione-toxin conjugates

    • Changes in glutathione homeostasis (GSH/GSSG ratios)

  • Comparative Analysis with mgst-Deficient Strains: Generate mgst knockout or knockdown strains to compare toxin sensitivity with wild-type cells, establishing the specific contribution of mgst to toxin resistance.

  • Subcellular Localization Studies: Use fluorescently tagged mgst to track potential redistribution within the cell following toxin exposure, as localization changes may indicate functional adaptations.

  • Temporal Dynamics: Implement time-course experiments to distinguish between immediate enzymatic responses and secondary adaptive responses involving transcriptional regulation.

  • Multi-Omics Integration: Combine transcriptomics, proteomics, and metabolomics data to create comprehensive models of how mgst functions within broader detoxification networks, similar to approaches used to study other D. discoideum GSTs .

What approaches can distinguish between redundant and unique functions of mgst compared to other GST family members in D. discoideum?

Distinguishing between redundant and unique functions of mgst compared to other GST family members requires sophisticated experimental designs:

  • Systematic Single and Multiple Gene Disruptions: Generate single knockouts for mgst and other GST genes, as well as combinations of double, triple, or complete GST family knockouts. Comparative phenotypic analysis can reveal functions that show enhanced defects in multiple knockouts (indicating redundancy) versus those specific to mgst disruption. Similar approaches with alpha class GSTs have revealed their specific roles in D. discoideum proliferation and development .

  • Substrate Specificity Profiling: Develop comprehensive substrate profiles for purified recombinant mgst and other D. discoideum GSTs using a diverse panel of potential substrates. Unique substrate preferences would suggest specialized functions.

  • Expression Pattern Analysis: Compare transcriptional and translational regulation patterns of mgst with other GST family members across developmental stages and stress conditions. Unlike alpha class GSTs that show marked expression changes during starvation , mgst may exhibit distinct regulatory patterns indicating specialized functions.

  • Protein Localization Studies: Map the subcellular distribution of fluorescently tagged GST family members to identify unique localization patterns suggesting specialized functions.

  • Interactome Analysis: Perform systematic protein-protein interaction studies using techniques like BioID or proximity labeling to identify unique versus shared interaction partners among GST family members.

  • Rescue Experiments: Test whether overexpression of one GST family member can rescue phenotypes caused by deletion of another, providing direct evidence of functional redundancy or specificity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.