Recombinant Dictyostelium discoideum Probable mitochondrial 2-oxoglutarate/malate carrier protein (ucpC)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Dictyostelium discoideum Probable Mitochondrial 2-Oxoglutarate/Malate Carrier Protein (ucpC) is a heterologously expressed protein belonging to the mitochondrial carrier family (MCF). It facilitates the transport of metabolites such as 2-oxoglutarate and malate across the mitochondrial inner membrane, playing roles in energy metabolism and redox balance . This protein is encoded by the ucpC gene (synonyms: slc25a11, DDB_G0284225) and is homologous to human SLC25A11 .

Primary Structure

The full-length recombinant ucpC protein consists of 318 amino acids (UniProt ID: Q54PY7) with a predicted molecular weight of ~35 kDa. Key structural motifs include six transmembrane helices typical of MCF proteins .

PropertyDetails
Amino Acid SequenceMSSFNTQNKNVLQTPIPAPTPQSQLKQFVIGGLAGMLSSAFTHPIDSLKVRMQLQGEGTG... (Full sequence in )
DomainsMitochondrial carrier domain (residues 1-318)
Post-Translational ModificationsNone reported; expressed with an N-terminal His tag for purification

Tertiary Structure

While no crystal structure is available for ucpC, homology modeling suggests a conserved tripartite structure with a substrate-binding cavity regulated by pH and nucleotide interactions .

Metabolite Transport

ucpC facilitates:

  • 2-Oxoglutarate/Malate Exchange: Critical for the malate-aspartate shuttle, linking mitochondrial and cytosolic metabolism .

  • Proton Transport: Collaborates with fatty acids to dissipate proton gradients, acting as a mild uncoupler of oxidative phosphorylation .

Regulatory Mechanisms

  • Activators: Free fatty acids (e.g., palmitate) enhance proton transport .

  • Inhibitors: GTP and ATP suppress activity, though ucpC exhibits lower GTP sensitivity compared to mammalian UCPs .

Recombinant Production

ParameterDetails
Host SystemEscherichia coli
TagN-terminal His tag
Purity>90% (SDS-PAGE verified)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
Reconstitution0.1–1.0 mg/mL in sterile water; glycerol (5–50%) recommended for stability

Key Studies

  1. Collaboration with Alternative Oxidase (AOX)

    • ucpC and AOX jointly regulate energy dissipation in D. discoideum mitochondria, particularly during starvation-induced aggregation .

    • AOX expression declines during growth phases, whereas ucpC remains constant, indicating a constitutive role in basal metabolism .

  2. Proton Transport Mechanism

    • ucpC-mediated proton leakage requires fatty acids, with unsaturated fatty acids (e.g., linoleic acid) showing higher activation efficiency .

    • Arginine 90 is critical for substrate binding, as confirmed by mutagenesis studies .

  3. Evolutionary Insights

    • ucpC is part of a mitochondrial proteome compendium in D. discoideum, with 32% of its mitochondrial proteins lacking homologs in humans or yeast .

Basic Research

  • Model for Mitochondrial Transport: Used to study conserved mechanisms of metabolite exchange and proton uncoupling .

  • Evolutionary Studies: Highlights divergence in mitochondrial proteomes across eukaryotes .

Therapeutic Potential

  • Cancer Metabolism: OGC (the mammalian ortholog of ucpC) is implicated in metabolic reprogramming, making ucpC a candidate for studying mitochondrial targeting strategies .

  • Neurodegeneration: UCP homologs in humans (e.g., UCP4/5) mitigate oxidative stress, suggesting ucpC could inform neuroprotective therapies .

Challenges and Future Directions

  • Structural Resolution: Cryo-EM or X-ray crystallography is needed to elucidate substrate-binding dynamics .

  • In Vivo Functional Analysis: Conditional knockouts in D. discoideum could clarify ucpC’s role in development and stress responses .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order notes. We will then fulfill your request as best as possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please let us know, and we will prioritize developing the specified tag.
Synonyms
ucpC; slc25a11; DDB_G0284225; Probable mitochondrial 2-oxoglutarate/malate carrier protein; OGCP; Mitochondrial substrate carrier family protein ucpC; Solute carrier family 25 member 11 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
ucpC
Target Protein Sequence
MSSFNTQNKNVLQTPIPAPTPQSQLKQFVIGGLAGMLSSAFTHPIDSLKVRMQLQGEGTG VGPKRGALKMLVHINQTEGFFTLYKGLSASLLRQATYTTTRFGLYDLIKDIVAKDDKPLP FTQKIMVGMLSGAGGAIVGTPADLTMVRMQADGKLPFNLRRNYKNVFDGIFRISKEEGII SLWKGCSPNLIRAMFMTAGQVSSYDQTKQLMLASGYFHDDIKTHLIASTTAAFVAAVATS PLDVIKTRIMNSPKTVTGELQYKGTFDCLSKTLRAEGFKAFYKGFNPYFMRLGPQTILTF IFVEQLNILWKKSQSYFK
Uniprot No.

Target Background

Function
Mitochondrial solute carriers facilitate the transport of metabolites, nucleotides, and cofactors across the mitochondrial inner membrane. This protein catalyzes the electroneutral exchange of 2-oxoglutarate for malate or other dicarboxylic acids across the inner mitochondrial membrane. This transport plays a crucial role in various metabolic processes, including the malate-aspartate shuttle, the oxoglutarate/isocitrate shuttle, gluconeogenesis from lactate, and nitrogen metabolism.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is ucpC and what is its primary function in Dictyostelium discoideum?

The ucpC protein is a probable mitochondrial 2-oxoglutarate/malate carrier in Dictyostelium discoideum that functions similarly to the 2-oxoglutarate/malate carrier (OGC) characterized in other organisms. Based on comparative studies with mammalian homologs, ucpC likely plays a critical role in the malate/aspartate shuttle, which is essential for maintaining redox balance between the mitochondrial matrix and cytosol . The protein mediates the electroneutral exchange of 2-oxoglutarate for malate across the inner mitochondrial membrane, thereby contributing to various metabolic pathways including the tricarboxylic acid (TCA) cycle and amino acid metabolism.

How does ucpC contribute to mitochondrial metabolism in Dictyostelium?

The ucpC protein likely contributes to Dictyostelium metabolism through dual functions: metabolite transport and proton transport. As a metabolite transporter, it facilitates the exchange of 2-oxoglutarate and malate across the mitochondrial inner membrane, supporting the malate/aspartate shuttle and contributing to NADH regeneration in the mitochondria . Recent research on homologous proteins suggests that beyond metabolite exchange, ucpC may also participate in proton transport when activated by specific compounds such as long-chain fatty acids or chemical protonophores like 2,4-dinitrophenol . This dual functionality potentially allows ucpC to influence both metabolic flux and mitochondrial membrane potential.

What structural features characterize the ucpC protein?

While the specific structure of Dictyostelium ucpC has not been fully elucidated, research on homologous mitochondrial carrier proteins suggests it likely contains:

  • Three tandemly repeated domains of approximately 100 amino acids each

  • Six transmembrane helices that form a barrel-like structure in the mitochondrial inner membrane

  • A characteristic mitochondrial carrier protein signature motif (P-X-[D/E]-X-X-[R/K])

  • Specific binding sites for substrates (2-oxoglutarate and malate)

  • Regions that interact with fatty acids and other activators of proton transport

Research on mammalian OGC has identified arginine 90 as a critical amino acid for the binding of fatty acids, ATP, 2-oxoglutarate, and malate, suggesting similar key residues likely exist in Dictyostelium ucpC . The protein likely adopts different conformational states during transport cycles, enabling substrate binding on one side of the membrane and release on the other.

How does ucpC-mediated proton transport relate to its role in cellular metabolism?

Recent research on mitochondrial carriers indicates that ucpC likely participates in a sophisticated regulatory network that balances metabolic demands with mitochondrial membrane potential. UcpC appears to increase proton membrane conductance only in the presence of natural protonophores (long-chain fatty acids) or chemical protonophores (such as 2,4-dinitrophenol) . This proton transport function correlates with the number of unsaturated bonds in fatty acids, suggesting a structure-dependent activation mechanism .

The dual functionality of ucpC has significant implications for cellular metabolism:

FunctionPhysiological RoleActivation Mechanism
Metabolite ExchangeSupports malate/aspartate shuttleSubstrate availability
Proton TransportModulates mitochondrial membrane potentialRequires protonophores (fatty acids or DNP)

This proton transport function might serve as a regulatory mechanism to prevent excessive mitochondrial membrane hyperpolarization, potentially protecting cells from reactive oxygen species production during metabolic fluctuations .

What experimental approaches are most effective for studying ucpC-mediated proton transport?

Studying ucpC-mediated proton transport requires specialized biophysical techniques:

  • Planar lipid bilayer conductance measurements: This approach allows direct measurement of membrane conductance (Gm) in the presence of purified recombinant ucpC, with and without activators such as fatty acids . The experimental setup typically involves:

    • Formation of a stable phospholipid bilayer

    • Incorporation of purified ucpC protein

    • Sequential addition of potential activators (fatty acids, DNP)

    • Measurement of electrical conductance changes using sensitive amplifiers

  • Proteoliposome-based assays: These allow measurement of substrate transport in parallel with proton movement:

    • Reconstitution of purified ucpC into liposomes

    • Loading liposomes with pH-sensitive fluorescent dyes

    • Simultaneous monitoring of substrate transport (using radiolabeled compounds like 14C-malate) and pH changes

  • Mitochondrial membrane potential monitoring in intact cells: Using membrane-potential sensitive dyes (TMRM, JC-1) to assess how ucpC activity impacts mitochondrial energetics in Dictyostelium cells with wild-type or modified ucpC expression.

How can homologous recombination techniques be optimized for studying ucpC in Dictyostelium?

Studying ucpC function in Dictyostelium can be challenging due to variable homologous recombination efficiency. Recent advances in recombination techniques suggest several approaches to enhance targeted genetic modifications:

  • Enhanced homologous recombination using loxP sites: This innovative approach can significantly increase recombination efficiency. By engineering a Dictyostelium line containing a single loxP site adjacent to the ucpC gene and introducing a replacement DNA also containing a single loxP site in a homologous position, recombination efficiency can be increased from typical rates of 0-30% to approximately 80% in the presence of CRE recombinase . This approach would involve:

    • Creating a parental strain with a loxP site near the ucpC gene

    • Constructing a replacement vector containing mutagenized ucpC with a homologous loxP site

    • Co-expression of Cre recombinase during transformation

    • Selection of transformants followed by screening for desired modifications

  • Temperature-sensitive (ts) mutant generation: The loxP-enhanced recombination approach has been successfully used to generate conditional mutants in other Dictyostelium genes, allowing for the isolation of numerous temperature-sensitive mutants . This approach could be adapted for ucpC to create conditional alleles that maintain function at permissive temperatures but lose activity at restrictive temperatures.

What expression systems yield optimal quantities of functional recombinant ucpC protein?

For biochemical and structural studies of ucpC, obtaining sufficient quantities of properly folded protein is essential. Several expression systems can be considered:

  • Homologous expression in Dictyostelium:

    • Advantages: Native post-translational modifications and folding environment

    • Methodology: Use of actin15 or discoidin promoters in extrachromosomal plasmids

    • Purification: Addition of affinity tags (His6, FLAG) for subsequent purification

    • Typical yield: 1-5 mg/L of culture

  • Heterologous expression in E. coli:

    • Advantages: High yield, simple culture conditions

    • Challenges: Proper folding of membrane proteins, inclusion body formation

    • Strategy: Expression as fusion proteins with solubility enhancers (MBP, SUMO)

    • Refolding protocols: Detergent screening (DDM, LDAO, Fos-choline) for optimal solubilization

  • Expression in insect cells:

    • Advantages: Eukaryotic folding machinery, higher yields than mammalian cells

    • Methodology: Baculovirus expression vector system with optimized secretion signals

    • Typical yield: 5-10 mg/L of culture with optimized conditions

For functional studies, reconstitution into proteoliposomes provides a controlled environment to assess transport activity. The choice of lipids (including cardiolipin content) significantly affects ucpC activity and should be optimized empirically.

What mutagenesis strategies can identify critical residues for ucpC substrate specificity and proton transport?

Based on research with homologous carriers, several mutagenesis approaches can identify functional residues in ucpC:

  • Alanine-scanning mutagenesis:

    • Systematic replacement of conserved residues with alanine

    • Focus on charged residues within transmembrane domains

    • Special attention to arginine residues (equivalent to R90 in mammalian OGC)

    • Functional assessment of each mutant for both metabolite and proton transport

  • Charge-reversal mutations:

    • Converting positively charged residues to negatively charged ones and vice versa

    • Evaluating the impact on substrate binding and transport kinetics

    • Identifying salt bridges critical for conformational changes during transport

  • Chimeric protein construction:

    • Creating fusion proteins between ucpC and other mitochondrial carriers

    • Swapping equivalent domains to identify regions responsible for substrate specificity

    • Using chimeras to map fatty acid binding sites that activate proton transport

Mutation TargetExpected Effect on Metabolite TransportExpected Effect on Proton TransportExperimental Readout
Arginine residues (e.g., R90 equivalent)Reduced substrate bindingDiminished fatty acid activationDecreased transport in both assays
Transmembrane charged residuesAltered substrate specificityMinimal effectChanged substrate preference in transport assays
C-terminal domainMinimal effectPotentially eliminated proton transportNormal metabolite transport, reduced proton conductance

How can CRISPR-Cas9 technology be adapted for efficient gene editing of ucpC in Dictyostelium?

CRISPR-Cas9 technology offers powerful approaches for studying ucpC function in Dictyostelium:

  • CRISPR-Cas9 delivery optimization:

    • Extrachromosomal plasmid expression of Cas9 and sgRNA under Dictyostelium promoters

    • Transient expression through electroporation of ribonucleoprotein complexes

    • Development of inducible Cas9 expression systems to minimize off-target effects

  • Homology-directed repair templates:

    • Design of repair templates with 500-1000 bp homology arms flanking the ucpC locus

    • Incorporation of selectable markers (G418 resistance) for positive selection

    • Addition of fluorescent tags for real-time visualization of ucpC localization and dynamics

  • Screening strategies:

    • PCR-based screening of genomic DNA from transformant pools

    • Functional screens based on altered growth under conditions requiring mitochondrial metabolism

    • Fluorescence-activated cell sorting for tagged variants

For enhancing homologous recombination efficiency, combining CRISPR-Cas9 with the loxP-based approach described earlier could yield synergistic improvements in targeting efficiency .

How should researchers analyze data from ucpC transport assays in the presence of different activators?

Analysis of ucpC transport data requires careful consideration of several factors:

  • Baseline correction and normalization:

    • Subtract background conductance measured in protein-free membranes

    • Normalize transport rates to protein concentration

    • Account for spontaneous leakage of substrates from proteoliposomes

  • Kinetic analysis:

    • Determine Michaelis-Menten parameters (Km, Vmax) for substrate transport

    • Calculate Hill coefficients to assess cooperativity

    • Use Lineweaver-Burk or Eadie-Hofstee plots to identify transport mechanisms

  • Activator impact assessment:

    • Construct dose-response curves for fatty acids with varying degrees of unsaturation

    • Calculate EC50 values for each activator

    • Apply appropriate competition models when multiple substrates or inhibitors are present

For fatty acid activation of proton transport, analysis should account for the correlation between activity and the number of unsaturated bonds . This relationship can be quantified using regression analysis, with the degree of unsaturation as the independent variable and transport activity as the dependent variable.

What approaches can distinguish between direct and indirect effects in ucpC functional studies?

Distinguishing direct from indirect effects in ucpC studies requires multiple complementary approaches:

  • Reconstituted systems versus cellular studies:

    • Direct effects: Observable in purified, reconstituted systems

    • Indirect effects: Present only in cellular contexts

    • Comparison: Systematic evaluation of phenomena in both systems

  • Acute versus chronic interventions:

    • Direct effects: Typically observable with acute treatments

    • Indirect effects: Often require time for compensatory mechanisms

    • Approach: Time-course experiments with varying exposure durations

  • Pharmacological verification:

    • Use of specific inhibitors at concentrations that target ucpC

    • Application of structurally different inhibitors that converge on ucpC

    • Control experiments with inhibitors of related pathways

  • Genetic complementation studies:

    • Rescue experiments with wild-type ucpC in knockout backgrounds

    • Introduction of specific mutations that selectively affect one function but not others

    • Heterologous complementation with functionally related carriers from other species

How can findings from Dictyostelium ucpC inform our understanding of mitochondrial carriers in human disease?

Research on Dictyostelium ucpC provides valuable insights into human mitochondrial carrier biology and disease:

  • Cancer metabolism connections:

    • Altered OGC activity has been implicated in cancer cell metabolic reprogramming

    • Insights from Dictyostelium ucpC regarding proton transport activation may explain how cancer cells maintain mitochondrial membrane potential despite altered metabolism

    • The dual function of ucpC (metabolite and proton transport) may represent a conserved regulatory mechanism exploited in cancer cells

  • Neurodegenerative disease relevance:

    • Mitochondrial dysfunction is a hallmark of neurodegenerative diseases

    • The proton transport function of mitochondrial carriers may contribute to neuroprotection against excitotoxicity and oxidative stress

    • Dictyostelium models provide a simplified system to understand fundamental mechanisms

  • Translational opportunities:

    • Identification of specific residues critical for ucpC function can guide development of selective inhibitors

    • Understanding the molecular basis of fatty acid activation could lead to novel therapeutics targeting cancer metabolism

    • Dictyostelium's genetic tractability allows rapid testing of hypotheses before translation to more complex models

What bioinformatic approaches can identify regulatory elements controlling ucpC expression?

Several bioinformatic strategies can uncover regulatory mechanisms governing ucpC expression:

  • Comparative promoter analysis:

    • Alignment of ucpC promoter regions across Dictyostelium species

    • Identification of conserved transcription factor binding sites

    • Prediction of CpG islands and epigenetic regulatory regions

  • Expression correlation networks:

    • Analysis of transcriptomic datasets to identify genes co-regulated with ucpC

    • Construction of gene regulatory networks to predict key transcription factors

    • Integration of time-course developmental data to map expression dynamics

  • Post-transcriptional regulation assessment:

    • Prediction of microRNA binding sites in ucpC mRNA

    • Analysis of RNA-binding protein motifs

    • Evaluation of mRNA secondary structures affecting translation efficiency

  • Epigenetic regulation prediction:

    • Analysis of chromatin immunoprecipitation data for histone modifications

    • Prediction of DNA methylation patterns

    • Identification of chromatin accessibility regions through ATAC-seq data mining

These approaches can be complemented with experimental validation through reporter assays, chromatin immunoprecipitation, and targeted mutagenesis of predicted regulatory elements.

What controls are essential when investigating ucpC function in genetic manipulation studies?

Rigorous controls are critical for interpreting genetic manipulation studies of ucpC:

  • Expression level controls:

    • Quantitative Western blot verification of protein levels

    • qRT-PCR measurement of transcript abundance

    • Construction of expression vectors with standardized promoters

  • Functional complementation controls:

    • Rescue experiments with wild-type ucpC in knockout backgrounds

    • Rescue with homologous carriers from other species

    • Empty vector controls for all constructs

  • Specificity controls:

    • Multiple independent knockdown or knockout lines

    • Use of structurally different inhibitors

    • Off-target effect assessment through genome-wide expression analysis

  • Phenotypic controls:

    • Analysis of cellular growth under different carbon sources

    • Measurement of mitochondrial membrane potential in manipulated cells

    • Assessment of respiratory capacity and ATP production

What are the key unresolved questions about ucpC biology in Dictyostelium?

Several important questions remain to be addressed:

  • Developmental regulation:

    • How does ucpC expression change during Dictyostelium development?

    • What is its role in the transition from single-cell amoebae to multicellular structures?

    • How is ucpC activity regulated during starvation and stress responses?

  • Structural determinants of dual functionality:

    • What structural features allow ucpC to perform both metabolite and proton transport?

    • How do fatty acids interact with the protein to activate proton transport?

    • Can these functions be separated through targeted mutagenesis?

  • Integration with cellular signaling:

    • How is ucpC activity regulated by post-translational modifications?

    • What signaling pathways modulate ucpC function during metabolic adaptation?

    • Does ucpC itself function as a metabolic sensor?

What emerging technologies show promise for advancing ucpC research?

Several cutting-edge technologies could accelerate ucpC research:

  • Cryo-electron microscopy:

    • Determination of high-resolution structures of ucpC in different conformational states

    • Visualization of ucpC-substrate and ucpC-activator complexes

    • Mapping of dynamic structural changes during transport cycles

  • Advanced microscopy techniques:

    • Super-resolution imaging of ucpC distribution within mitochondria

    • Single-molecule tracking to assess mobility and interactions

    • FRET-based sensors to monitor ucpC activity in real-time

  • Metabolomics integration:

    • Fluxomics approaches to quantify metabolite flow through ucpC-dependent pathways

    • Isotope tracing studies to determine the contribution of ucpC to specific metabolic routes

    • Correlation of metabolite profiles with ucpC activity states

  • Synthetic biology approaches:

    • Design of artificial ucpC variants with enhanced or novel functions

    • Creation of minimal synthetic circuits to study ucpC regulation

    • Development of genetically encoded sensors for ucpC substrates

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.