Recombinant Dictyostelium discoideum Probable mitochondrial chaperone BCS1-B (bcsl1b)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and arranged in advance, incurring additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for customers.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
bcsl1b; DDB_G0291910; Probable mitochondrial chaperone BCS1-B; BCS1-like protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-458
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
bcsl1b
Target Protein Sequence
MENVITNNNKGLPKSILKFIPEPIQPLFENPFFSAGFGLIGVGSILAMGRKGFQQAMIQS RRYFFVSVEVPSKDKSFHWLMEWLATKKNKNTRHVSVETTFHQHESGDIVSRINFVPSVG THYVFYRGRVIKVERSREKNVIDMNSGNLWESITLTTLGTGRQVFQNLIEEAKEMALEKE EGKTLIYTSMGTDWRRFGHPRRKRPISSVILDKGKSELIIQDVKKFLNNSDWYNDRGIPY RRGYLLYGPPGTGKSSFITALAGELQLSICILNLAGKSVSDTSLNQLLATAPQRSIILLE DIDSAIQTGNHDLSAKSNSANAPSISSGGLQYQGYYGNPSVSSGGSALTFSGLLNALDGV AASEGRILFMTTNHLEKLDKVLIRPGRVDLQIEIGLCSSYQMEQMFLKFYPTDFDLAKQF VEKLENYKFSPAQLQAYFMTYSNNSIEAINNLNELIKK
Uniprot No.

Target Background

Function
A chaperone protein essential for the assembly of mitochondrial respiratory chain complex III.
Database Links
Protein Families
AAA ATPase family, BCS1 subfamily
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What expression systems are recommended for producing recombinant BCS1-B in D. discoideum?

For optimal expression of recombinant BCS1-B in D. discoideum, researchers typically use extrachromosomal plasmids with strong, constitutive promoters like actin15 or discoidin. Transformation can be performed using standard electroporation protocols optimized for D. discoideum, as described in several studies . The procedure involves:

  • Growing AX3 cells to mid-log phase (4-6 × 10^6 cells/ml)

  • Cold-shocking cells in electroporation buffer for 30 minutes

  • Mixing with 30μg of plasmid DNA in 4mm electroporation cuvettes

  • Electroporating at 0.85kV and 25mF with two pulses (5 seconds between pulses)

  • Transferring to flask with fresh HL5 medium

  • Gradually introducing selection agent (typically G418) from 5μg/ml to 20μg/ml over 1-2 weeks

Adding a C-terminal tag (GFP, RFP, or epitope tags) facilitates detection while preserving the N-terminal mitochondrial targeting sequence .

How can I verify that my recombinant BCS1-B properly localizes to mitochondria?

Verification of proper mitochondrial localization requires a multi-faceted approach:

TechniqueProtocol HighlightsExpected ResultsLimitations
Fluorescence microscopyExpress BCS1-B with C-terminal GFP/RFP; co-stain with MitoTrackerPunctate pattern overlapping with MitoTrackerMay not distinguish submitochondrial localization
Subcellular fractionationDifferential centrifugation to isolate mitochondria; Western blot analysisEnrichment in mitochondrial fractionPotential cross-contamination between fractions
Protease protection assayTreat isolated mitochondria with increasing protease concentrations ± detergentProtection of internal domains in intact mitochondriaRequires specific antibodies or detectable tags
Immunogold EMFix cells, section, label with antibodies, visualize with electron microscopyGold particles at mitochondrial inner membraneTechnically challenging, requires specialized equipment

The most convincing evidence comes from combining at least two independent approaches .

What are the optimal conditions for purifying active recombinant BCS1-B from D. discoideum?

Purification of active BCS1-B requires careful consideration of its membrane-associated nature. A recommended protocol includes:

  • Cell disruption: Harvest 5-10 × 10^9 cells and disrupt using a French press or sonication in buffer containing 50mM HEPES pH 7.5, 200mM sucrose, 1mM EDTA, 1mM DTT, and protease inhibitors.

  • Mitochondrial isolation: Perform differential centrifugation (1,000g for 10min, then supernatant at 10,000g for 15min) to pellet mitochondria.

  • Membrane protein extraction: Solubilize mitochondria with mild detergents like digitonin (1-2%) or DDM (0.5-1%) in buffer containing 50mM HEPES pH 7.5, 150mM NaCl, 10% glycerol, and 5mM ATP.

  • Affinity purification: If tagged, use appropriate affinity resin (Ni-NTA for His-tag, anti-FLAG for FLAG-tag) with gentle washing and elution conditions.

  • Size exclusion chromatography: Perform final purification step to isolate properly folded oligomeric BCS1-B.

Critical parameters include maintaining physiological pH (7.2-7.5), including ATP (1-5mM) in all buffers, and minimizing time between cell disruption and final purification to preserve activity .

How should I design knockout or knockdown experiments to study BCS1-B function?

Designing effective genetic manipulation strategies for BCS1-B requires careful consideration:

For knockout approaches:

  • Use homologous recombination with a vector containing 5' and 3' flanking regions of the bcsl1b gene surrounding a selectable marker (typically blasticidin resistance).

  • Screen transformants using PCR to confirm correct insertion.

  • Verify protein absence using Western blotting or mass spectrometry.

For inducible knockdown approaches:

  • Use RNAi constructs targeting unique regions of bcsl1b mRNA.

  • Consider tetracycline-inducible or doxycycline-inducible systems for temporal control.

  • Quantify knockdown efficiency using qRT-PCR and Western blotting.

In both cases, include appropriate controls:

  • Empty vector transformants

  • Rescue experiments with wild-type bcsl1b expression

  • Phenotypic comparison with known mitochondrial mutants

When analyzing phenotypes, examine:

  • Growth rates in axenic medium

  • Development on bacterial lawns or non-nutrient agar

  • Mitochondrial function (membrane potential, respiration rate)

  • Response to oxidative stress challenges

What assays best evaluate BCS1-B chaperone activity in vitro and in vivo?

Comprehensive evaluation of BCS1-B chaperone activity requires both in vitro biochemical assays and in vivo functional assessments:

In vitro assays:

  • ATPase activity: Measure ATP hydrolysis rates using colorimetric phosphate detection or coupled enzyme assays. Expected activity for functional BCS1-B: 5-20 nmol Pi/min/mg protein, with 2-3 fold stimulation in the presence of substrate proteins.

  • Protein unfolding prevention: Monitor aggregation of model substrates (e.g., citrate synthase) under thermal stress ± purified BCS1-B using light scattering.

  • Substrate binding: Assess interaction with known substrates (e.g., Rieske Fe-S protein) using surface plasmon resonance or microscale thermophoresis.

In vivo assays:

  • Complex III assembly: Analyze respiratory complex assembly using blue native PAGE from wild-type vs. BCS1-B-deficient mitochondria.

  • Protein import efficiency: Measure import rates of radiolabeled substrates into isolated mitochondria.

  • Respiratory function: Determine oxygen consumption rates using respirometry in intact cells and isolated mitochondria.

  • Stress response: Evaluate growth and development under various stressors (oxidative, thermal, nutrient limitation) .

How can I investigate the role of BCS1-B in D. discoideum development and social behavior?

Investigating BCS1-B's role in D. discoideum development requires specialized approaches that connect mitochondrial function to multicellular development:

  • Developmental timing assays:

    • Plate wild-type and BCS1-B-deficient cells on non-nutrient agar

    • Document morphological stages at regular intervals (0, 4, 8, 12, 16, 20, 24h)

    • Quantify timing of key developmental transitions (aggregation, mound formation, slug formation, culmination)

  • Chimeric development analysis:

    • Mix fluorescently labeled wild-type and BCS1-B-deficient cells at defined ratios

    • Track cell distribution in chimeric structures using confocal microscopy

    • Calculate proportional representation in prestalk and prespore regions

    • Determine spore formation efficiency in competition assays

  • Social behavior assessment:

    • Implement cell adhesion assays to measure changes in cohesiveness

    • Analyze cell sorting patterns in mixed populations

    • Quantify cheating potential using spore formation efficiency measurements in mixed populations

  • Metabolic profiling during development:

    • Measure ATP levels at different developmental stages

    • Track mitochondrial morphology changes during development

    • Analyze expression patterns of BCS1-B throughout the developmental cycle

Key metrics should include spore formation efficiency (SFE), which can be calculated as the ratio between final spore count and initial cell number .

What approaches can reveal the interactome of BCS1-B in the D. discoideum mitochondrial proteome?

To comprehensively characterize the BCS1-B interactome in D. discoideum mitochondria, employ multiple complementary approaches:

  • Proximity-dependent biotin labeling:

    • Express BCS1-B-BioID or BCS1-B-APEX2 fusion proteins

    • Induce biotinylation of proximal proteins

    • Purify biotinylated proteins using streptavidin affinity

    • Identify by mass spectrometry

    • Expected proximity partners include respiratory complex III components and mitochondrial import machinery

  • Co-immunoprecipitation with quantitative proteomics:

    • Express tagged BCS1-B (FLAG, HA, or GFP)

    • Isolate mitochondria and solubilize with mild detergents

    • Perform immunoprecipitation with appropriate antibodies

    • Compare to control immunoprecipitations using SILAC or TMT labeling

    • Focus on proteins with >2-fold enrichment and p<0.05 significance

  • Genetic interaction screening:

    • Generate double mutants combining BCS1-B mutation with other mitochondrial genes

    • Assess synthetic growth defects or suppressor relationships

    • Construct genetic interaction networks

  • Structural analysis:

    • Purify BCS1-B complexes for cryo-EM analysis

    • Identify structural interactions with substrate proteins

    • Model conformational changes during the chaperone cycle

Integration of these datasets provides a confidence-ranked interaction network, with highest confidence assigned to interactions identified by multiple methods .

How does BCS1-B function differ between unicellular and multicellular phases of the D. discoideum life cycle?

Examining BCS1-B function across different life cycle phases requires stage-specific analyses:

  • Expression profiling:

    • Monitor BCS1-B expression levels using qRT-PCR and Western blotting

    • Sample at defined timepoints (0h, 4h, 8h, 12h, 16h, 20h, 24h post-starvation)

    • Correlate with developmental markers and mitochondrial remodeling events

  • Mitochondrial dynamics assessment:

    • Track mitochondrial morphology changes using fluorescence microscopy

    • Quantify mitochondrial mass, membrane potential, and distribution

    • Analyze respiratory complex assembly at different developmental stages

  • Metabolic reprogramming analysis:

    • Measure oxygen consumption rates in vegetative cells vs. developing structures

    • Quantify ATP production and energy storage compounds

    • Determine reliance on glycolysis vs. oxidative phosphorylation

  • Stage-specific phenotypic rescue:

    • Implement stage-specific expression systems (e.g., prestalk or prespore specific promoters)

    • Assess rescue efficiency of developmental defects

    • Determine critical periods for BCS1-B function

Expected findings might include differential requirements for BCS1-B during energy-intensive developmental transitions, particularly during aggregation and culmination phases where mitochondrial function may be critical for providing the energy needed for morphogenesis .

How should I optimize BCS1-B antibody production and validation for D. discoideum research?

Developing and validating antibodies against D. discoideum BCS1-B requires careful optimization:

  • Antigen design strategies:

    • Select unique regions with high antigenicity (typically hydrophilic domains)

    • Avoid transmembrane regions and highly conserved functional domains

    • Consider both peptide antigens (15-25 amino acids) and recombinant protein fragments (50-150 amino acids)

    • Generate multiple antibodies targeting different epitopes

  • Validation methods:

    • Western blotting comparing wild-type vs. BCS1-B knockout/knockdown samples

    • Immunoprecipitation followed by mass spectrometry confirmation

    • Immunofluorescence microscopy with appropriate controls

    • Preabsorption with immunizing peptide/protein

  • Optimization parameters:

    • Test different fixation methods for immunofluorescence (PFA, methanol, acetone)

    • Optimize blocking conditions (BSA vs. milk, detergent concentrations)

    • Determine ideal antibody dilutions through titration series

    • Compare different detection systems (chemiluminescence vs. fluorescence)

  • Specificity controls:

    • Include BCS1-B knockout as negative control

    • Test cross-reactivity with other AAA-family ATPases

    • Verify recognition of both native and denatured forms

Researchers should consider recombinant antibody approaches, which offer improved reproducibility and reduced batch-to-batch variation compared to traditional polyclonal antibodies, as highlighted in recent D. discoideum studies .

What are the most common pitfalls in analyzing mitochondrial function in BCS1-B mutant D. discoideum strains?

Researchers should be aware of several common pitfalls when analyzing mitochondrial function in BCS1-B mutants:

  • Secondary adaptations:

    • Problem: Long-term cultivation of BCS1-B mutants can lead to compensatory mutations or metabolic adaptations

    • Solution: Use inducible knockdown systems or recently generated knockout clones; compare multiple independent clones

  • Growth condition variables:

    • Problem: Mitochondrial phenotypes often vary with growth conditions (medium composition, temperature, cell density)

    • Solution: Standardize growth conditions; analyze phenotypes under multiple defined conditions; document all parameters

  • Cell cycle effects:

    • Problem: Mitochondrial properties change during cell cycle progression

    • Solution: Synchronize cells or account for cell cycle distribution in population measurements

  • Artifacts in isolated mitochondria:

    • Problem: Isolation procedures can damage mitochondria, creating artificial functional defects

    • Solution: Compare results from isolated mitochondria with in situ measurements; use gentle isolation procedures; verify mitochondrial integrity

  • Interpretation errors:

    • Problem: Attributing all observed phenotypes directly to BCS1-B loss when they may be secondary effects

    • Solution: Implement rescue experiments; use combinations of assays; consider broader metabolic context

  • Technical variability:

    • Problem: High variability in sensitive assays like respiration measurements

    • Solution: Increase biological and technical replicates; standardize cell numbers and conditions; include appropriate controls in each experiment

How can I reconcile contradictory data about BCS1-B function from different experimental approaches?

When faced with contradictory data regarding BCS1-B function, implement a systematic reconciliation strategy:

This structured approach allows researchers to develop a more nuanced understanding of BCS1-B function that accommodates seemingly contradictory observations through context-dependent interpretation .

How might emerging technologies enhance our understanding of BCS1-B function in D. discoideum?

Several cutting-edge technologies offer promising approaches to deepen our understanding of BCS1-B function:

  • CRISPR-Cas9 genome editing:

    • Generate precise point mutations in functional domains

    • Create conditional alleles for temporal control

    • Implement CRISPR interference for tunable gene expression

    • Tag endogenous BCS1-B at genomic loci

  • Cryo-electron tomography:

    • Visualize BCS1-B in its native mitochondrial environment

    • Determine structural organization within respiratory supercomplexes

    • Capture different conformational states during the chaperone cycle

  • Single-cell transcriptomics and proteomics:

    • Profile cell-to-cell variability in BCS1-B expression

    • Identify subpopulations with distinct mitochondrial states

    • Track developmental trajectories with single-cell resolution

  • Metabolic flux analysis:

    • Trace isotopically labeled substrates through metabolic pathways

    • Quantify alterations in metabolic flux in BCS1-B mutants

    • Measure energetic consequences of BCS1-B dysfunction

  • Optogenetics and chemogenetics:

    • Develop tools for rapid, reversible control of BCS1-B activity

    • Manipulate BCS1-B function with spatial and temporal precision

    • Probe acute versus chronic effects of BCS1-B inhibition

What is the evolutionary significance of BCS1-B conservation across diverse eukaryotes?

The evolutionary conservation of BCS1-B across eukaryotes presents intriguing research opportunities:

  • Comparative genomics approaches:

    • Analyze BCS1 homologs across diverse eukaryotic lineages

    • Identify conserved domains versus lineage-specific adaptations

    • Correlate sequence conservation with mitochondrial respiratory complex organization

  • Functional complementation studies:

    • Test whether BCS1 homologs from other species can rescue D. discoideum BCS1-B mutants

    • Identify critical residues through domain-swapping experiments

    • Determine whether functional constraints differ across evolutionary distances

  • Evolutionary rate analysis:

    • Calculate selection pressures on different BCS1-B domains

    • Compare evolutionary rates with interacting partners

    • Identify episodes of accelerated evolution and their potential significance

  • Ancestral sequence reconstruction:

    • Infer ancestral BCS1 sequences at key evolutionary nodes

    • Experimentally test the properties of reconstructed ancestral proteins

    • Trace the evolutionary trajectory of BCS1 function

This evolutionary perspective can provide insights into fundamental constraints on mitochondrial chaperone function and reveal how BCS1-B has been adapted for specialized functions in different lineages, including the unique developmental program of D. discoideum .

How does mitochondrial stress affect BCS1-B function during D. discoideum development?

Examining the relationship between mitochondrial stress and BCS1-B function during development requires integrated approaches:

  • Stress induction protocols:

    • Apply specific mitochondrial stressors (respiratory inhibitors, ROS generators, membrane potential disruptors)

    • Implement heat shock or nutrient limitation paradigms

    • Create genetic models of mitochondrial dysfunction

  • BCS1-B adaptive responses:

    • Monitor changes in BCS1-B expression, localization, and post-translational modifications

    • Analyze BCS1-B client interactions under stress conditions

    • Determine how stress affects BCS1-B ATPase activity and oligomerization

  • Developmental consequences:

    • Assess how mitochondrial stress affects developmental timing and morphogenesis

    • Determine whether BCS1-B overexpression can rescue development under stress conditions

    • Analyze cell fate decisions and pattern formation under mitochondrial stress

  • Signaling integration:

    • Identify signaling pathways connecting mitochondrial stress to developmental programs

    • Determine whether BCS1-B functions as a direct stress sensor

    • Map interactions between mitochondrial stress response and developmental signaling networks

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.