Recombinant Dictyostelium discoideum Probable mitochondrial thiamine pyrophosphate carrier (mcfK)

Shipped with Ice Packs
In Stock

Description

Protein Identification and Nomenclature

The mitochondrial thiamine pyrophosphate carrier, commonly referred to as mcfK in Dictyostelium discoideum, is identified in scientific databases through several designations. According to available data, the protein is formally recognized by the UniProt ID Q54VS7 and is alternatively known as slc25a19, DDB_G0280161, Mitochondrial substrate carrier family protein K, or Solute carrier family 25 member 19 homolog . These multiple designations reflect its evolutionary relationship with similar transport proteins across species, particularly its homology with human SLC25A19, which performs comparable functions in human mitochondria .

Expression Systems and Production Strategies

The recombinant production of mcfK has been successfully achieved using various expression systems, each offering specific advantages for different research applications. According to available data, the protein has been expressed in:

  1. Escherichia coli bacterial systems

  2. Cell-free expression systems

  3. Yeast-based expression

  4. Baculovirus-infected insect cell systems

  5. Mammalian cell expression systems

Among these, E. coli systems appear to be commonly used for producing His-tagged versions of the full-length protein (1-323 amino acids), as indicated by commercial product specifications . The cell-free expression system offers advantages for transmembrane proteins like mcfK, potentially preserving native conformation without the complications of cellular toxicity that may arise during overexpression .

Purification and Quality Assessment

Following expression, the recombinant mcfK protein undergoes purification processes to ensure high purity for research applications. Purification typically involves affinity chromatography, particularly for His-tagged versions, followed by additional purification steps as required. The purity levels of commercially available recombinant mcfK protein typically range from greater than 85% to greater than 90% as determined by SDS-PAGE analysis . These high purity standards ensure reliable results in subsequent research applications and functional studies.

Table 1: Recombinant mcfK Protein Production Specifications

CharacteristicSpecification
Protein LengthFull Length (1-323 amino acids)
Expression SystemsE. coli, Cell Free, Yeast, Baculovirus, Mammalian Cell
TagsHis-tag (N-terminal)
Purity>85% to >90% by SDS-PAGE
Molecular Weight36,272 Da
FormLyophilized powder
UniProt IDQ54VS7
Gene ID8622410

Mitochondrial Transport Function

The primary function of mcfK, as suggested by its classification as a mitochondrial thiamine pyrophosphate carrier, is to facilitate the transport of thiamine pyrophosphate (TPP) across the inner mitochondrial membrane. TPP serves as an essential cofactor for several key mitochondrial enzymes involved in energy metabolism, including pyruvate dehydrogenase, α-ketoglutarate dehydrogenase, and branched-chain α-keto acid dehydrogenase complexes . By ensuring appropriate TPP availability within the mitochondria, mcfK plays a critical role in maintaining efficient energy production and metabolic function.

Role in Cellular Metabolism and Energy Production

Research on Dictyostelium discoideum has shown that during nutrient limitation, these organisms undergo significant metabolic adjustments, including decreased mitochondrial respiration and reduced oxygen consumption rates . As a transporter of TPP, mcfK likely plays an important role in these metabolic adaptations. The availability of TPP in mitochondria directly impacts the activity of TPP-dependent enzymes central to the citric acid cycle and energy production pathways. Therefore, regulation of mcfK function may be part of the cellular response to nutrient availability, influencing the transition between unicellular and multicellular states characteristic of D. discoideum .

Potential Involvement in Oxidative Stress Response

Studies have indicated that reactive oxygen species (ROS) generation as a consequence of nutrient limitation leads to significant metabolic changes in D. discoideum . The relationship between mitochondrial function, ROS production, and nutrient sensing involves multiple mitochondrial proteins, potentially including mcfK. Thiamine and its derivatives have recognized antioxidant properties, suggesting that regulation of thiamine pyrophosphate transport could be relevant to cellular responses to oxidative stress. The sequestration of sulfur-containing compounds during nutrient limitation in D. discoideum affects mitochondrial metabolism , a process that may involve adjustments in the activity of transporters like mcfK.

Model System for Mitochondrial Transport Studies

Recombinant mcfK protein provides researchers with a valuable tool for investigating mitochondrial transport mechanisms. The availability of purified protein enables detailed biochemical characterization, including substrate specificity, transport kinetics, and regulatory mechanisms. Such studies contribute to our fundamental understanding of mitochondrial biology and cellular metabolism, with potential implications for understanding related human transporters like SLC25A19 .

Applications in Dictyostelium discoideum as a Model Organism

Dictyostelium discoideum has emerged as an important model organism for studying various cellular processes, including phagocytosis, autophagy, and cell-autonomous defense mechanisms . As a component of mitochondrial metabolism, mcfK research contributes to understanding how energy metabolism influences these cellular functions. D. discoideum shares many molecular features with mammalian macrophages and has conserved signal transduction pathways, making it relevant for studying fundamental cellular processes with implications for human biology .

Relevance to Disease Models and Therapeutic Development

The human homolog of mcfK, SLC25A19, has been implicated in neurological disorders and metabolic diseases . Therefore, studies using recombinant D. discoideum mcfK protein can provide insights into the function and regulation of this important transporter family, potentially contributing to the development of therapeutic approaches for human diseases associated with mitochondrial transport defects. D. discoideum has been established as a model system for studying neurological disorders , further highlighting the relevance of mcfK research in this organism.

Table 2: Research Applications of Recombinant mcfK Protein

Application AreaSpecific Uses
Biochemical StudiesSubstrate specificity, transport kinetics, structure-function relationships
Antibody ProductionGeneration of specific antibodies for detection and localization studies
Drug ScreeningIdentification of compounds that modulate transporter activity
Structural BiologyCrystallization trials, structural determination attempts
Protein-Protein InteractionsIdentification of interaction partners and regulatory proteins

Functional Assays for Transporter Activity

Assessing the functional activity of recombinant mcfK typically involves reconstitution into artificial membrane systems, such as liposomes, followed by transport assays measuring the movement of radiolabeled or fluorescently tagged substrates. Such assays can determine transport kinetics, substrate specificity, and the effects of potential inhibitors. These functional studies are essential for confirming that the recombinant protein maintains native activity and for characterizing its transport properties in detail.

Integration with Dictyostelium discoideum Biology

D. discoideum undergoes a fascinating life cycle transition from a unicellular to multicellular form in response to nutrient limitation . Understanding how mitochondrial transporters like mcfK contribute to this transition provides insights into the metabolic regulation of cellular differentiation. The regulated sequestration of sulfur during nutrient limitation has been shown to impact mitochondrial metabolism in D. discoideum , suggesting potential connections to the function of mitochondrial transporters like mcfK. The availability of recombinant protein facilitates focused studies on how this specific transporter contributes to these broader biological processes.

Comparative Analysis with Mammalian Homologs

The human homolog of mcfK, SLC25A19, shares functional similarities and is involved in thiamine metabolism . Comparative studies between recombinant D. discoideum mcfK and human SLC25A19 can provide evolutionary insights and help establish D. discoideum as a model for understanding human mitochondrial transport processes. Such comparative approaches may identify conserved functional elements and regulatory mechanisms with relevance to human health and disease.

Integrative Studies with Cellular Metabolism

The connection between mcfK function and broader aspects of cellular metabolism in D. discoideum represents an important area for future research. Integrative studies combining recombinant protein biochemistry with cellular metabolomics and mitochondrial physiology could elucidate how this transporter contributes to metabolic adaptations during nutrient limitation and other environmental stresses. The role of thiamine pyrophosphate transport in regulating energy metabolism during the transition to multicellularity is particularly interesting given the established importance of metabolic changes in this process .

Therapeutic Relevance and Translational Potential

Given the homology between D. discoideum mcfK and human SLC25A19, research on this protein system has potential translational relevance. Dysfunction of human SLC25A19 has been associated with neurological disorders , suggesting that insights gained from the D. discoideum model could contribute to understanding disease mechanisms and developing therapeutic approaches. The availability of recombinant protein facilitates screening for compounds that modulate transporter activity, potentially leading to the development of novel therapeutic strategies.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag.
Synonyms
mcfK; slc25a19; DDB_G0280161; Probable mitochondrial thiamine pyrophosphate carrier; Mitochondrial substrate carrier family protein K; Solute carrier family 25 member 19 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-323
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
mcfK
Target Protein Sequence
MIITTSNDEDKKTNVFVELAAGSFSGALTRFIVAPLDVVKIRLQLQRTQLNNNSNNNNKI IGKENVNYRGIINTMSKVIREEGIRSLWKGNFSAELLWVTYAAIQFSTYNEIIGILDPEY RKHQQRTDKDKPNYKPSSSITMIGGASAGILSTIVSYPFDIIRTNIVNNHNKTNFKQTFK TIIARNGGYSNLFSGINSSLFQIVPQMGFQFTFYETFKFISNKYTSSVNNNNNNPLNQFT CGLLSGAISKFLVLPFDVVKKRLQVNEKVGYGMKSCFRDLYFNEGGVKAFFKGGTPGIVK AGLAAALSFTFFEQSKRILLNKQ
Uniprot No.

Target Background

Function
This protein is a mitochondrial transporter responsible for mediating the uptake of thiamine pyrophosphate (ThPP) into mitochondria.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the mitochondrial thiamine pyrophosphate carrier (mcfK) in Dictyostelium discoideum?

The mcfK protein (Q54VS7) is a 323-amino acid membrane protein that functions as a carrier for thiamine pyrophosphate (TPP) across the mitochondrial membrane in the cellular slime mold Dictyostelium discoideum. It belongs to the solute carrier family 25 (SLC25A19 homolog), which facilitates the transport of various metabolites across the mitochondrial membrane . Dictyostelium discoideum has emerged as an important model organism for cellular and developmental biology research, with mcfK representing one of its critical metabolic transport proteins that maintains mitochondrial function .

How should recombinant mcfK protein be stored and handled in laboratory settings?

Proper handling of recombinant mcfK is crucial for maintaining protein integrity and experimental reproducibility. The following protocol is recommended:

  • Storage conditions: Store at -20°C/-80°C upon receipt

  • Aliquoting: Necessary for multiple use to avoid repeated freeze-thaw cycles

  • Working aliquots: Can be maintained at 4°C for up to one week

  • Buffer composition: Typically supplied in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

  • Reconstitution procedure:

    • Briefly centrifuge the vial prior to opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to 5-50% final concentration (50% recommended) for long-term storage

    • Re-aliquot for storage at -20°C/-80°C

What is the function of thiamine pyrophosphate in cellular metabolism?

Thiamine pyrophosphate (TPP) is an essential cofactor for multiple enzymatic reactions in central carbon metabolism. The importance of TPP transport stems from its critical role in:

  • Mitochondrial energy production through the pyruvate dehydrogenase complex and α-ketoglutarate dehydrogenase in the TCA cycle

  • Transketolase reactions in the pentose phosphate pathway

  • Branched-chain α-keto acid dehydrogenase complex activity

Evidence from studies on homologous proteins indicates that impaired TPP transport can significantly affect mitochondrial function and cellular energy metabolism . In Dictyostelium, proper TPP transport is likely crucial for both the unicellular growth phase and the multicellular developmental phase that occurs under starvation conditions .

How does mcfK compare to its human homolog SLC25A19?

The mcfK protein shares functional homology with human SLC25A19, initially misidentified as the mitochondrial deoxyribonucleotide carrier (DNC) but later correctly identified as a mitochondrial thiamine pyrophosphate carrier . This functional conservation makes Dictyostelium discoideum a valuable model system for studying TPP transport mechanisms relevant to human health.

FeatureD. discoideum mcfKHuman SLC25A19
Protein length323 amino acids~320 amino acids
Subcellular localizationMitochondrial membraneMitochondrial inner membrane
Primary functionThiamine pyrophosphate transportThiamine pyrophosphate transport
Gene synonymsmcfK, DDB_G0280161SLC25A19, DNC, MCPHA, THMD4
Model system applicationsDevelopment, mitochondrial functionNeurological disorders, metabolic diseases
UniProt IDQ54VS7Q9HC21

This conservation highlights the evolutionary importance of this transport mechanism and supports the use of Dictyostelium as a model organism for studying TPP transport mechanisms relevant to human mitochondrial disorders .

What experimental approaches can be used to study mcfK function in mitochondrial metabolism?

Several complementary approaches can be employed to investigate mcfK function:

  • Genetic manipulation techniques:

    • REMI (Restriction Enzyme-Mediated Integration) mutagenesis for generating mcfK knockout strains

    • REMI-Seq for high-throughput parallel phenotyping experiments to identify mcfK-related phenotypes

    • Creation of fluorescently tagged mcfK fusion proteins for localization studies

  • Biochemical and cellular assays:

    • Isolation of mitochondria from wild-type and mcfK mutant strains for comparative functional studies

    • In vitro transport assays using purified recombinant protein reconstituted in liposomes

    • Metabolomic analysis to identify changes in TPP-dependent pathways when mcfK function is altered

  • Developmental phenotyping:

    • Quantitative assessment of development using fluorescent reporter strains

    • Microscopic observation of morphological defects in mcfK mutants during multicellular development

    • High-throughput microscopy to measure growth rates and developmental progression

How can knockout models of mcfK be generated in Dictyostelium discoideum?

Generating mcfK knockout models can be accomplished through several approaches:

  • REMI (Restriction Enzyme-Mediated Integration):

    • This established technique involves introducing a plasmid containing a selectable marker into Dictyostelium cells along with a restriction enzyme

    • The enzyme creates random cuts in the genome, allowing plasmid integration

    • REMI mutants with insertions in the mcfK gene can be identified by PCR screening or sequencing

  • REMI-Seq approach:

    • This newer technique allows the relative abundance of each REMI mutant to be determined in complex pools

    • Enables parallel phenotyping experiments to identify how mcfK mutations affect responses to various conditions

    • Particularly useful for identifying subtle phenotypes that might be missed in individual mutant analyses

  • Homologous recombination:

    • Design knockout constructs with mcfK flanking sequences surrounding a selectable marker

    • Integrating this construct through homologous recombination disrupts the mcfK gene

    • Confirmation through PCR, Southern blotting, and Western blotting to verify gene disruption and absence of protein expression

Each approach has advantages depending on the specific research question, with REMI-Seq offering high throughput but less precision, while targeted approaches offer more controlled gene disruption.

What techniques are most effective for visualizing mcfK localization in Dictyostelium cells?

Multiple complementary imaging approaches can be employed to study mcfK localization:

  • Fluorescent protein fusion:

    • Generation of mcfK-GFP (or other fluorescent protein) fusion constructs

    • Expression under native or controlled promoters

    • Live cell imaging to observe dynamic localization patterns

    • Co-localization with mitochondrial markers (e.g., MitoTracker dyes)

  • Immunofluorescence approaches:

    • Utilization of recombinant antibodies developed specifically for Dictyostelium

    • Antibodies against the His-tag in recombinant proteins

    • Fixation and permeabilization protocols optimized for mitochondrial membrane proteins

    • Dual labeling with mitochondrial markers to confirm localization

  • Advanced microscopy techniques:

    • Confocal microscopy for high-resolution optical sectioning

    • Super-resolution microscopy (e.g., STED, PALM, STORM) for detailed subcellular localization

    • Time-lapse imaging to capture dynamic changes during development or in response to metabolic stressors

Similar approaches have been successfully used with other Dictyostelium proteins, such as presenilin components, which were localized to the endoplasmic reticulum using fluorescent tagging .

How can recombinant mcfK be used in structural and functional studies?

Recombinant mcfK protein provides a versatile tool for multiple research applications:

  • Structural studies:

    • X-ray crystallography of purified protein to determine three-dimensional structure

    • Cryo-electron microscopy as an alternative approach for membrane proteins

    • Circular dichroism spectroscopy to analyze secondary structure elements

    • Computational modeling based on homology with other mitochondrial carriers

  • Functional characterization:

    • Reconstitution into liposomes for in vitro transport assays

    • Binding studies with TPP using techniques like isothermal titration calorimetry

    • Site-directed mutagenesis to identify critical residues for transport function

    • Complementation studies in mcfK-deficient Dictyostelium strains

  • Interaction studies:

    • Identification of binding partners using pull-down assays with the His-tagged protein

    • Analysis of potential regulatory mechanisms affecting TPP transport

    • Investigation of the role of mcfK in mitochondrial protein complexes

The availability of recombinant protein expressed in E. coli with >90% purity provides an excellent starting point for these detailed molecular studies .

What is the relationship between mcfK function and neurological disease models in Dictyostelium?

Dictyostelium has emerged as a valuable model for studying neurological disorders, and potential connections with mcfK function represent an intriguing research direction:

  • Relevance to neurological disorders:

    • Mitochondrial dysfunction is implicated in many neurodegenerative diseases

    • Thiamine deficiency and altered thiamine metabolism are associated with neurological conditions

    • Human SLC25A19 mutations cause Amish microcephaly and neuropathy with bilateral striatal necrosis

  • Experimental approaches:

    • Study mcfK function in Dictyostelium strains expressing human disease-associated proteins

    • Compare mitochondrial function in wild-type and mcfK mutant backgrounds

    • Investigate whether mcfK dysfunction affects phenotypes in established Dictyostelium neurological disease models

    • Test whether compounds that modulate neurological disease progression also affect mcfK function

  • Specific neurological connections:

    • Alzheimer's disease: Examine potential interactions between mcfK and presenilin proteins

    • Parkinson's disease: Investigate relationships with LRRK2 homologs (Roco proteins)

    • Huntington's disease: Study impacts on energy metabolism and protein aggregation

The table below summarizes some key Dictyostelium models for neurological disorders that could be studied in relation to mcfK function:

Neurological DisorderDictyostelium HomologuePhenotypes in Mutant StrainsPotential mcfK Connection
Parkinson's diseaseRoco proteins (gbpC, qkgA, pats1, roco4-11)Decreased mound size, aberrant fruiting body morphology, decreased chemotaxisMitochondrial metabolism effects on development and signaling
Alzheimer's diseasePresenilin homologsDevelopmental defects, altered protein processingPotential metabolic interactions
Other neurological disordersVarious homologsDevelopmental and cellular phenotypesEnergy metabolism connections

This research direction could provide valuable insights into the role of mitochondrial TPP transport in neurological disease pathogenesis .

What are the key considerations for expressing and purifying recombinant mcfK protein?

Successful expression and purification of functional mcfK protein requires careful attention to several factors:

  • Expression system optimization:

    • E. coli is the established system for mcfK expression, but codon optimization may improve yields

    • Consider membrane protein-specific expression strains (e.g., C41/C43)

    • Optimize induction conditions (temperature, IPTG concentration, duration)

    • Test different fusion tags beyond the standard His-tag if purification challenges arise

  • Purification strategy:

    • Utilize a two-step purification process:
      a) Initial immobilized metal affinity chromatography (IMAC) using the His-tag
      b) Secondary size exclusion or ion exchange chromatography for higher purity

    • Include appropriate detergents to maintain membrane protein solubility

    • Consider on-column refolding if inclusion bodies form

  • Quality control:

    • Verify protein identity by mass spectrometry

    • Assess purity by SDS-PAGE (>90% purity is achievable)

    • Confirm proper folding through circular dichroism or functional assays

    • Test batch-to-batch consistency for reproducible experiments

How can Dictyostelium discoideum be utilized as a model system for studying mcfK and related proteins?

Dictyostelium offers several advantages as a model system for studying mcfK function:

  • Experimental tractability:

    • Simple laboratory growth conditions in association with bacteria or in axenic medium

    • Short life cycle with growth and development largely separable

    • Reproducible development achieved by removing growth medium and plating cells on non-nutrient agar

    • Amenable to high-throughput screening approaches

  • Genetic manipulation capabilities:

    • Generation of mutant libraries through REMI

    • REMI-Seq method allows parallel phenotyping experiments

    • Creation of fluorescently tagged proteins for localization studies

    • Development of recombinant antibodies specifically for Dictyostelium proteins

  • Relevance to human health:

    • Conservation of key metabolic pathways between Dictyostelium and humans

    • Functional homology between mcfK and human SLC25A19

    • Established value as a model for neurological disorders, where mitochondrial dysfunction is often implicated

    • Potential for drug discovery and toxicity screening applications

The unique combination of unicellular growth and multicellular development makes Dictyostelium particularly valuable for studying the role of metabolic transport proteins like mcfK in different cellular contexts and developmental stages .

What are the methodological challenges in studying mitochondrial carrier proteins like mcfK?

Researching mitochondrial membrane proteins presents several technical challenges:

  • Structural analysis difficulties:

    • Membrane proteins are notoriously challenging for structural determination

    • Difficulties in obtaining crystals suitable for X-ray crystallography

    • Challenges in maintaining native conformation during purification

    • Need for specialized detergents or lipid environments to preserve structure and function

  • Functional assessment complexities:

    • Transport assays typically require reconstitution into artificial membrane systems

    • Challenges in developing high-throughput assays for transport activity

    • Difficulties in distinguishing direct and indirect effects in cellular systems

    • Limited availability of specific inhibitors for mechanistic studies

  • Organism-specific considerations:

    • Optimizing mitochondrial isolation from Dictyostelium cells

    • Developing appropriate knockout validation strategies

    • Establishing phenotypic readouts that specifically reflect mcfK function

    • Translating findings between Dictyostelium and mammalian systems

Addressing these challenges requires interdisciplinary approaches combining molecular biology, biochemistry, structural biology, and cell biology techniques.

What emerging technologies could advance mcfK research?

Several cutting-edge technologies hold promise for deeper understanding of mcfK function:

  • Advanced structural biology approaches:

    • Cryo-electron microscopy for high-resolution structures without crystallization

    • Hydrogen-deuterium exchange mass spectrometry for dynamic structural information

    • Integrative structural biology combining multiple data sources

    • Molecular dynamics simulations to study transport mechanisms

  • Genome editing advancements:

    • CRISPR-Cas9 adaptation for more precise genetic manipulation in Dictyostelium

    • Base editing for introducing specific mutations without double-strand breaks

    • Inducible gene expression/knockout systems for temporal control of mcfK expression

    • Multiplexed genome editing to study mcfK interactions with other genes

  • Single-cell and spatial technologies:

    • Single-cell transcriptomics to study cell-type specific effects of mcfK dysfunction

    • Spatial transcriptomics to map expression patterns during development

    • Advanced imaging techniques with higher resolution and throughput

    • Correlative light and electron microscopy for ultrastructural localization

These technological advances could overcome current limitations and provide new insights into mcfK structure, function, and regulation.

How might mcfK research contribute to understanding human mitochondrial diseases?

Research on mcfK has significant potential to advance understanding of human mitochondrial disorders:

  • Translational relevance:

    • Human SLC25A19 mutations cause rare but severe neurological disorders

    • Insights from Dictyostelium mcfK could illuminate disease mechanisms

    • Potential for identifying novel therapeutic targets

    • Development of screening systems for drug discovery

  • Mechanistic understanding:

    • Elucidation of fundamental transport mechanisms conserved across species

    • Identification of regulatory pathways controlling TPP transport

    • Understanding of how TPP transport interfaces with other mitochondrial functions

    • Insights into environmental influences on mitochondrial carrier activity

  • Therapeutic implications:

    • Potential for discovering compounds that modulate TPP transport

    • Development of strategies to bypass defective transport

    • Testing therapeutic hypotheses in a simple model before moving to complex systems

    • Contributions to precision medicine approaches for mitochondrial disorders

The study of mcfK in Dictyostelium represents a valuable component of the broader research effort to understand and treat mitochondrial diseases that affect human health.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.