Recombinant Dictyostelium discoideum Probable phosphatidate cytidylyltransferase (cdsA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Dictyostelium discoideum Probable Phosphatidate Cytidylyltransferase (cdsA)

Recombinant Dictyostelium discoideum Probable Phosphatidate Cytidylyltransferase (cdsA) is an enzyme involved in the biosynthesis of phospholipids. It catalyzes the conversion of phosphatidic acid to CDP-diacylglycerol, a crucial intermediate in the synthesis of phosphatidylinositol, phosphatidylglycerol, and cardiolipin. These phospholipids are essential for cellular membrane structure and signaling pathways.

Molecular Function and Biological Process

  • Molecular Function: The enzyme exhibits phosphatidate cytidylyltransferase activity, which is essential for the formation of CDP-diacylglycerol from phosphatidic acid .

  • Biological Process: It participates in the CDP-diacylglycerol biosynthetic process, contributing to the synthesis of various phospholipids necessary for membrane integrity and cellular signaling .

Potential Applications and Significance

  • Lipid Metabolism: The enzyme's role in lipid biosynthesis makes it a potential target for studying lipid metabolism disorders.

  • Membrane Biogenesis: Its involvement in producing phospholipids necessary for membrane structure suggests applications in understanding cellular membrane dynamics.

Data Table: Comparison of Phosphatidate Cytidylyltransferases

Enzyme/ProteinOrganismFunctionSubcellular Location
cdsADictyostelium discoideumPhosphatidate cytidylyltransferase activityCytoplasmic side of the endoplasmic reticulum (predicted)
CDS2HumansConversion of phosphatidic acid to CDP-diacylglycerolInner mitochondrial membrane and endoplasmic reticulum
DDB_G0277049Dictyostelium discoideumPhosphatidate cytidylyltransferase activity in mitochondriaMitochondrial inner membrane

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard glycerol final concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cdsA; DDB_G0269742; Probable phosphatidate cytidylyltransferase; CDP-DAG synthase; CDP-DG synthase; CDP-diacylglycerol synthase; CDS; CDP-diglyceride pyrophosphorylase; CDP-diglyceride synthase; CTP:phosphatidate cytidylyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-479
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
cdsA
Target Protein Sequence
MRTDNIRNRKEQLKKQEKKDFDSSKDEETSTSDEEESSGGNRSKIAGKENHQNKNIINQK TNNNNNNNNIKEKDIIDSSVNNADNLKATDPPSAKYKKLAIRSVMGAFMIGFFTIVLSTD HFIVALFVIALQLLVFKEMIALRYIEAKEKKIPHFRTLNWFFLFTSFFFFYAKPILITLA NYYPDIFQHFVRYHLWHSFSLYCIGFVLFILTLRKGVYRYQFSQLTWTLMILMMVVVQSN FLISNIYQGLIWFILPVSIIVCNDIFAYFNGFFLGKKFINRPLMKISPNKTWEGFIGATG WTLLFAYYFCGFLLKYDWIVCPKGNTGFMESLHCTRDPVFLEKEFIFPPEITTIAFKYLG ITLLPFTYIPIQFHALVLALFGSLIAPFGGFFASGIKRAYKVKDFDTIFPGHGGVTDRTD CQFIMGLFIHVYYNTFIKTLEIDPTFIWQNIMMLSMEEKMVIYEKLKQSIEFTTGTITA
Uniprot No.

Target Background

Database Links
Protein Families
CDS family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the role of phosphatidate cytidylyltransferase (cdsA) in Dictyostelium discoideum?

Phosphatidate cytidylyltransferase (cdsA) in D. discoideum likely functions similarly to its orthologs in other organisms, catalyzing the synthesis of cytidine diphosphate-diacylglycerol, which serves as an essential phospholipid intermediate for the production of membrane phosphatidylglycerol and cardiolipin . As a key enzyme in phospholipid metabolism, cdsA plays a critical role in membrane biogenesis and composition maintenance. In the context of D. discoideum's genetic tractability and conserved DNA repair pathways, studying cdsA provides insights into fundamental cellular processes that are relevant to higher eukaryotes, including humans .

Why is Dictyostelium discoideum a useful model organism for studying cdsA function?

D. discoideum offers several advantages as a model system for studying cdsA function:

  • Genetic tractability: The organism allows for easy gene disruption and modification, facilitating the creation of cdsA mutants .

  • Conservation with higher eukaryotes: D. discoideum contains orthologs of several proteins otherwise limited to vertebrates .

  • Unique life cycle: Its ability to transition from unicellular to multicellular forms enables the study of cdsA in different developmental contexts .

  • Single copy genes: D. discoideum predominantly has single copy genes encoding various proteins, simplifying genetic analyses compared to organisms with multiple gene copies .

  • Well-characterized genome: The fully sequenced genome facilitates comprehensive genetic studies .

How is recombinant D. discoideum cdsA typically expressed and purified for research?

While specific methods for D. discoideum cdsA expression weren't detailed in the search results, standard approaches would involve:

  • Cloning the cdsA gene from D. discoideum genomic DNA or cDNA using PCR with specific primers.

  • Inserting the gene into an appropriate expression vector compatible with either D. discoideum itself or heterologous systems like E. coli or insect cells.

  • Expressing the recombinant protein using optimized conditions (temperature, induction parameters, etc.).

  • Purifying via affinity chromatography (His-tag, GST-tag) followed by size exclusion and/or ion exchange chromatography.

  • Confirming protein identity and purity through SDS-PAGE, Western blotting, and mass spectrometry.

The unique genetic manipulation capabilities of D. discoideum also allow for endogenous tagging approaches to study cdsA in its native context .

What are the best methods to measure cdsA enzymatic activity in D. discoideum extracts?

Measuring cdsA enzymatic activity requires quantifying the conversion of phosphatidic acid to CDP-diacylglycerol. Recommended methodological approaches include:

  • Radiometric assays: Using 14C or 32P-labeled substrates to track product formation.

    • Incubate purified enzyme or cell extracts with radiolabeled CTP and phosphatidic acid

    • Separate reaction products by thin-layer chromatography

    • Quantify labeled CDP-diacylglycerol by scintillation counting

  • Spectrophotometric coupled assays: Linking CdsA activity to a detectable color change.

  • Mass spectrometry approaches: For label-free detection of reaction products.

  • In vivo metabolic labeling: To monitor phospholipid metabolism in intact cells.

The enzymatic assays should be optimized for D. discoideum-specific conditions, including pH, temperature, and cofactor requirements.

How can one create and validate cdsA knockout or knockdown strains in D. discoideum?

D. discoideum's genetic tractability makes it ideal for generating cdsA-deficient strains:

  • Gene disruption approaches:

    • Homologous recombination with a resistance cassette

    • CRISPR-Cas9 gene editing

  • Validation methods:

    • PCR confirmation of gene disruption

    • Western blotting to verify protein absence

    • RT-qPCR to confirm reduced transcript levels

    • Enzymatic activity assays to demonstrate functional loss

    • Phospholipid profiling to detect expected changes in membrane composition

  • Phenotypic analysis:

    • Growth rate measurements

    • Developmental progression monitoring

    • Microscopic examination of membrane structures

    • Stress response testing, particularly to DNA-damaging agents

The ability to disrupt multiple genes in D. discoideum enables the creation of complex genetic backgrounds to study compensatory mechanisms and pathway redundancies .

What phenotypic assays are most informative when studying cdsA function in D. discoideum?

Based on the known roles of phosphatidate cytidylyltransferase and D. discoideum biology, the following phenotypic assays would be most informative:

  • Membrane integrity assays:

    • Fluorescent dye uptake/exclusion tests

    • Membrane permeability measurements

    • Lipidomic analysis to quantify changes in phospholipid composition

  • Developmental analyses:

    • Time-course monitoring of multicellular development

    • Cell-type specific marker expression

    • Spore formation and germination efficiency

  • DNA damage response:

    • Sensitivity to DNA-damaging agents

    • Quantification of DNA repair efficiency

    • Nuclear localization of DNA repair proteins

  • Cell cycle progression:

    • Flow cytometry analysis

    • Mitotic index determination

    • Cell division rate measurements

  • Stress response:

    • Survival under various stressors (oxidative, osmotic, etc.)

    • Heat shock response

    • Antimicrobial peptide sensitivity (based on related findings in other organisms)

How does cdsA activity influence membrane phospholipid composition and DNA repair mechanisms in D. discoideum?

While direct evidence linking cdsA to DNA repair in D. discoideum isn't provided in the search results, several connections can be explored:

  • Membrane-DNA repair interplay:

    • Phospholipid composition affects membrane properties and protein localization

    • DNA repair proteins often associate with specific membrane domains

    • Changes in membrane charge (due to altered phospholipid composition) could impact recruitment of repair factors

  • Potential mechanisms:

    • Altered phosphatidylglycerol and cardiolipin levels might affect nuclear membrane structure

    • Lipid microdomains could serve as scaffolds for DNA repair protein assemblies

    • Phospholipid metabolism might influence signaling pathways that regulate DNA repair

  • Research approaches:

    • Lipidomic analysis of nuclear membranes in wild-type versus cdsA-mutant cells

    • Chromatin immunoprecipitation to assess DNA repair protein recruitment

    • Fluorescence microscopy to track repair factor localization

    • DNA damage sensitivity assays following genetic or pharmacological manipulation of cdsA

D. discoideum's remarkable DNA repair capabilities make it an excellent model for investigating these potential connections .

What is the relationship between cdsA function and antimicrobial peptide resistance in D. discoideum?

Based on findings in other organisms such as Streptococcus mitis/oralis, cdsA mutations can significantly alter membrane phospholipid composition, leading to antimicrobial peptide resistance . In D. discoideum, this relationship could be investigated through:

  • Membrane charge analysis:

    • Zeta potential measurements of wild-type versus cdsA-mutant cells

    • Fluorescent probe labeling of anionic phospholipid microdomains

  • Antimicrobial peptide sensitivity testing:

    • Survival assays using various cationic antimicrobial peptides

    • Fluorescently labeled peptide binding and uptake studies

    • Time-kill kinetics analysis

  • Mechanistic investigations:

    • Lipidomic profiling to quantify changes in phosphatidylglycerol and cardiolipin

    • Microscopy to visualize peptide-membrane interactions

    • Electrophysiology to measure membrane potential alterations

  • Evolutionary considerations:

    • Comparison with antimicrobial resistance mechanisms in other organisms

    • Assessment of natural selective pressures in D. discoideum's soil habitat

This research direction connects fundamental membrane biology with potential applications in understanding antimicrobial resistance mechanisms .

How does cdsA activity change during D. discoideum development and differentiation?

D. discoideum's unique life cycle makes it ideal for studying stage-specific regulation of cdsA:

  • Developmental expression profiling:

    • RT-qPCR analysis of cdsA transcript levels throughout development

    • Western blotting to track protein abundance

    • Enzymatic activity assays at different developmental stages

  • Cell-type specific analysis:

    • Single-cell transcriptomics to identify expression patterns in specific cell populations

    • Immunofluorescence microscopy with cell-type markers

    • Cell-type separation followed by biochemical analysis

  • Functional impact assessment:

    • Stage-specific cdsA disruption or overexpression

    • Phospholipid composition analysis during development

    • Correlation with developmental checkpoints

  • Potential developmental roles:

    • Membrane remodeling during aggregation

    • Phospholipid requirements for spore formation and dormancy

    • Role in stalk cell vacuolization and cell death

D. discoideum's developmental transition provides a unique window to study how phospholipid metabolism adapts to changing cellular functions .

How can studies of D. discoideum cdsA inform understanding of human diseases related to phospholipid metabolism?

Research on D. discoideum cdsA has translational relevance to human health:

  • Conservation with human orthologs:

    • D. discoideum serves as a simplified model for studying conserved pathways

    • Findings can provide insights into basic mechanisms relevant to human CDS proteins

  • Disease relevance:

    • Phospholipid metabolism disorders

    • Neurodegenerative diseases linked to membrane dysfunction

    • Cancer cell metabolism

  • Methodological approaches:

    • Complementation studies with human CDS genes in D. discoideum cdsA mutants

    • Structural analysis of conserved domains

    • Drug screening using D. discoideum as a model system

  • Comparative analysis:

    • Functional conservation and divergence across species

    • Regulatory mechanisms controlling phospholipid homeostasis

D. discoideum's genetic tractability makes it valuable for modeling human disease mechanisms in a simplified system .

What experimental considerations are important when interpreting cdsA mutant phenotypes in D. discoideum?

Careful experimental design and controls are essential when working with cdsA mutants:

  • Genetic background effects:

    • Use of isogenic strains for comparison

    • Multiple independent mutant isolates to confirm phenotypes

    • Complementation with wild-type cdsA to verify specificity

  • Compensatory mechanisms:

    • Assessment of related phospholipid biosynthesis pathways

    • Analysis of potential genetic suppressors

    • Time-course studies to detect adaptive responses

  • Technical considerations:

    • Growth conditions standardization

    • Cell density and developmental stage matching

    • Appropriate statistical analysis

  • Validation approaches:

    • Multiple independent methods to confirm phenotypes

    • Correlation of biochemical and cellular observations

    • Dose-response relationships with genetic or pharmacological interventions

The ability to manipulate multiple genes simultaneously in D. discoideum is particularly valuable for disentangling complex phenotypes and pathway interactions .

How can single-cell analysis techniques enhance understanding of cdsA function in D. discoideum populations?

Single-cell approaches offer important insights into cdsA function in heterogeneous populations:

  • Single-cell transcriptomics:

    • Identification of subpopulations with distinct cdsA expression patterns

    • Correlation with other gene expression profiles

    • Developmental trajectory analysis

  • Single-cell imaging techniques:

    • Live-cell phospholipid biosynthesis monitoring

    • Subcellular localization of cdsA and interaction partners

    • Membrane domain visualization

  • Flow cytometry applications:

    • Sorting based on membrane properties

    • Correlation with cell cycle and developmental status

    • Isolation of rare cell populations for further analysis

  • Integration with population-level data:

    • Reconciling single-cell heterogeneity with bulk measurements

    • Identifying emergent properties in multicellular development

    • Mathematical modeling of population dynamics

Recent studies in D. discoideum have revealed populations with spontaneous DNA damage, identified through single-cell transcriptomics , suggesting similar approaches could identify cells with altered cdsA function.

What are the emerging technologies most likely to advance research on D. discoideum cdsA in the next decade?

Several cutting-edge technologies show promise for cdsA research:

  • CRISPR-based approaches:

    • Base editing for precise mutation introduction

    • CRISPRi/CRISPRa for tunable gene expression control

    • Lineage tracing during development

  • Advanced microscopy:

    • Super-resolution imaging of membrane domains

    • Label-free lipid visualization techniques

    • Correlative light and electron microscopy

  • Metabolomics and lipidomics:

    • Spatial metabolomics for subcellular resolution

    • Temporal profiling during dynamic processes

    • Integration with proteomics and transcriptomics

  • Computational methods:

    • Machine learning for phenotype classification

    • Systems biology modeling of phospholipid metabolism

    • Molecular dynamics simulations of membrane properties

  • Synthetic biology approaches:

    • Minimal synthetic membranes with defined composition

    • Orthogonal phospholipid biosynthesis pathways

    • Biosensors for real-time activity monitoring

These emerging technologies will enable more precise manipulation and analysis of cdsA function in the context of D. discoideum's unique biology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.