Recombinant Dictyostelium discoideum Probable serine/threonine-protein kinase abkD (abkD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment according to your needs.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
abkD; adckB2; DDB_G0284897; Probable serine/threonine-protein kinase abkD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-695
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
abkD
Target Protein Sequence
MKILKFSLLSKLKHKDFIVTSFRNNIINSIKNNNTNNNGLLKFSNNKYNFLNNNNNNNNN NVNKINNVYYINNNFKNVMENKIKPSSIQFFSSLSNKYNLNSFTTTKPQPCQAKPPSSKQ QQQQQQQQQQQQQQQQQQQSKKKTSKDRLRDILKKTVITPQEFLNVLQRFAKNYKKTIAS ILAAIALIIYSYETPDSYFGSMMNVIVRFYRAMKCATKIMINYKILSYTPEKSSEYLEKS KICHQESADLILDLCLTNGGLYIKAGQYIASLNHILPIQYTKTLSVLQDQAPWRDFYEVE SVFLKDLGNAPNHYFSDFDRLPIAAASLAQVHRAITKEGEEVAVKVQYVDLQRNFDGDIF THNVLLTLVNMAFPDFEFNWMAEEMKNVLIKELDFSQEADNAERAAQDLSSNNNAYIPKV FRPYSSKRILTTEFIHGCKINNVQAIRSMGLSEKTVSQRFMEIMCEQIFIHAFVHVDPHA GNVLVRQHPNHPNQPQIVLLDHGLYREYDEEFRLNFCNLYKNLVLCNNKKVEKYSKALGV QNWKLFSTMILMRNFEGSSVGLSNSISSEELEKLLSGAIERLKDINLLMKAMPRHLLLIL RNNNLLRSINMELGSPVNRFSIMARYAAKGLNSNSSKNSGIIRLVKSVEEKVSLEVMLKG YELYYYFVNRILSILIRLHIINPEKLIKDQMKKLG
Uniprot No.

Target Background

Database Links
Protein Families
Protein kinase superfamily, ADCK protein kinase family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Dictyostelium discoideum and why is it valuable as a model organism for studying protein kinases like abkD?

Dictyostelium discoideum is a soil-dwelling social amoeba belonging to the phylum Amoebozoa. Despite lacking a nervous system, it has become a valuable model organism for several reasons:

  • It possesses a fully sequenced, low redundancy genome with many genes and signaling pathways found in more complex eukaryotes .

  • Its haploid genome allows researchers to introduce one or multiple gene disruptions with relative ease .

  • The organism transitions from unicellular amoebae to a multicellular structure within a short 24-hour developmental cycle, enabling the rapid detection of developmental phenotypes .

  • It shares many common features with metazoan development but in a much shorter timeframe .

  • Many genes implicated in human diseases, including those encoding protein kinases, have homologs in Dictyostelium .

These characteristics make Dictyostelium particularly useful for studying protein kinases like abkD, which are involved in cellular signaling pathways and may have conserved functions across species.

How is recombinant abkD protein typically expressed and purified for research applications?

The expression and purification of recombinant abkD kinase typically follows these methodological steps:

  • Plasmid construction: A plasmid encoding the D. discoideum abkD protein is constructed, often with fusion tags for detection and purification (similar to how other Dictyostelium proteins are prepared) .

  • Expression system selection: Common expression systems include:

    • Yeast (as seen with other Dictyostelium proteins)

    • E. coli (bacterial expression)

    • Wheat germ extract for cell-free expression

  • Protein expression: The expression host is cultured and induced for protein production. The expression conditions (temperature, induction time, media composition) are optimized to maximize soluble protein yield.

  • Affinity purification: The recombinant protein is typically fused with affinity tags such as:

    • His tag (N-terminal 10xHis)

    • GST tag

    • Myc tag (C-terminal)

  • Purification verification: SDS-PAGE analysis is performed to confirm the presence and assess protein purity, typically aiming for >85% purity .

This general approach allows researchers to obtain purified recombinant abkD protein for subsequent biochemical and functional characterization.

What are the known functional domains of abkD kinase in Dictyostelium discoideum?

The abkD protein in Dictyostelium discoideum belongs to the ABC1 family of protein kinases . While specific domain information for abkD is limited in the provided search results, we can infer its likely structure based on related protein kinases:

  • Kinase domain: As a serine/threonine protein kinase, abkD contains a catalytic domain responsible for phosphoryl transfer reactions .

  • ATP-binding region: Like other kinases, it likely contains a conserved ATP-binding region essential for its enzymatic activity.

  • Substrate-binding sites: Specific regions that determine substrate specificity.

Protein kinases like abkD typically share a common catalytic core structure while differing in their regulatory domains and substrate recognition elements. The alignment of abkD with other kinases suggests it plays roles in cellular signaling pathways involved in Dictyostelium's development and response to environmental stimuli.

How can ABAB study design be applied to investigate the functional role of abkD in Dictyostelium development?

The ABAB study design (also known as reversal design) can be effectively applied to investigate abkD function through the following methodological approach:

  • Baseline Measurement (A1):

    • Measure the phenotype of interest (e.g., development rate, chemotaxis efficiency, or cell differentiation) in wild-type Dictyostelium under standard conditions.

    • Document quantitative parameters like cell movement rates, developmental timing, or gene expression profiles .

  • Intervention Phase (B1):

    • Introduce an intervention affecting abkD function, such as:

      • Conditional expression of dominant-negative abkD variants

      • Application of specific kinase inhibitors

      • Inducible gene silencing using RNA interference

    • Continue measuring the same parameters as in A1 while the intervention is active .

  • Return to Baseline (A2):

    • Remove the intervention (e.g., wash out inhibitor, turn off conditional expression).

    • Measure the same parameters to determine if the phenotype returns to baseline .

  • Reintroduction of Intervention (B2):

    • Reapply the same intervention used in B1.

    • Measure parameters again to confirm reproducibility of the effect .

This design is particularly valuable for Dictyostelium research because:

  • It eliminates the need for large sample sizes required in randomized controlled trials.

  • Each organism serves as its own control, reducing variability.

  • It provides strong evidence for causality when the phenotype changes predictably with each phase transition.

  • It is well-suited for studying time-dependent developmental processes in Dictyostelium .

The ABAB design has been successfully used in studies of other cellular processes and could be effectively applied to abkD functional characterization, particularly when examining its role in developmental transitions or stress responses.

What are the challenges and solutions in generating abkD knockout mutants in Dictyostelium discoideum?

Generating abkD knockout mutants in Dictyostelium presents several challenges along with established solutions:

Challenges:

  • Potential lethality: If abkD is essential for viability, complete knockout may be impossible.

  • Functional redundancy: Other kinases may compensate for abkD loss, masking phenotypes.

  • Developmental stage-specific functions: abkD may have different roles during various life cycle stages.

  • Off-target effects: CRISPR or homologous recombination methods may affect non-target genes.

Solutions and Methodological Approaches:

  • Homologous recombination: Dictyostelium's haploid genome facilitates gene disruption through homologous recombination.

    • Design constructs with selection markers (e.g., blasticidin resistance) flanked by sequences homologous to the abkD locus.

    • Colony PCR can be used to evaluate successful homologous recombination .

  • Conditional knockouts:

    • Implement tetracycline-inducible or developmentally regulated promoters to control abkD expression.

    • This allows study of essential genes by inducing knockout at specific times.

  • CRISPR-Cas9 system: Recently adapted for Dictyostelium, allowing precise genome editing.

  • Insertional mutagenesis libraries: Facilitate pharmacogenetic screens that enhance understanding of gene function .

  • Complementation strategies:

    • Test knockout specificity by reintroducing wild-type abkD or mutant variants.

    • This can also be used to map functional domains .

The haploid nature of Dictyostelium is advantageous for these genetic manipulations, while the availability of expression constructs enables studies on protein localization and function .

How does abkD kinase activity influence autophagy pathways in Dictyostelium discoideum?

The relationship between abkD kinase activity and autophagy in Dictyostelium can be analyzed through several experimental approaches:

  • Autophagy assessment in abkD mutants:

    • Dictyostelium is an established model for studying autophagy mechanisms .

    • Autophagy flux in abkD-deficient cells can be monitored using:

      • GFP-Atg8 translocation assays

      • Electron microscopy to visualize autophagosomes

      • Western blotting to track autophagy markers like Atg8 lipidation

  • Key pathway interactions:

    • ABC1 family kinases like abkD may function in energy sensing pathways that regulate autophagy .

    • Research indicates potential crosstalk between abkD and the AMPK (AMP-dependent protein kinase) signaling pathway, which is known to regulate autophagy in response to energy stress .

    • Experimental evidence suggests that chronic activation of AMPK can influence cellular phenotypes that might be regulated by abkD or related kinases .

  • Developmental regulation:

    • During Dictyostelium's multicellular development, autophagy plays crucial roles in cell differentiation and morphogenesis.

    • abkD may influence these processes through phosphorylation of autophagy-related proteins.

  • Stress responses:

    • Under nutrient deprivation, ER stress, or other cellular stresses, abkD may modulate autophagy induction.

    • This can be studied using ABAB experimental designs to assess reversible effects of abkD manipulation on autophagy markers .

The study of these interactions is facilitated by the genetic tractability of Dictyostelium and the availability of tools for both gene manipulation and protein analysis .

What methodologies can be used to identify and validate the in vivo substrates of abkD kinase?

Identifying the in vivo substrates of abkD kinase requires a multi-faceted approach:

  • Phosphoproteomics:

    • Compare phosphopeptide profiles between wild-type and abkD-deficient Dictyostelium using mass spectrometry.

    • Quantitative approaches like SILAC (Stable Isotope Labeling with Amino acids in Cell culture) can identify differentially phosphorylated proteins.

    • Temporal analysis during development can reveal stage-specific substrates.

  • Kinase assays with candidate substrates:

    • Express and purify recombinant abkD with affinity tags (His, GST) .

    • Test phosphorylation of potential substrates in vitro using:

      • Radioactive ATP (γ-32P-ATP) incorporation

      • Phospho-specific antibodies

      • MS detection of phosphorylated residues

  • Substrate consensus sequence analysis:

    • Identify common motifs in confirmed substrates.

    • Use bioinformatics to predict additional potential substrates.

    • Validate predictions experimentally.

  • Protein-protein interaction studies:

    • Yeast two-hybrid screening to identify binding partners.

    • Co-immunoprecipitation followed by mass spectrometry.

    • Bimolecular Fluorescence Complementation (BiFC) for in vivo validation.

  • Substrate validation:

    • Generate phospho-deficient and phospho-mimetic mutants of candidate substrates.

    • Assess functional consequences in vivo using ABAB study design .

    • Perform rescue experiments in abkD-deficient backgrounds.

  • Proximity-dependent labeling:

    • Generate abkD fusion with BioID or APEX2 to label proximal proteins.

    • Identify labeled proteins as potential substrates or interactors.

These complementary approaches can build a comprehensive map of abkD substrates and signaling networks in Dictyostelium.

How does the Attention-Based Knowledge Distillation (ABKD) algorithm relate to research on the abkD kinase in Dictyostelium?

While the Attention-Based Knowledge Distillation (ABKD) algorithm and the abkD kinase in Dictyostelium share an acronym, they represent entirely different concepts:

ABKD Algorithm:

  • ABKD is a novel knowledge distillation approach for Graph Neural Networks (GNNs) .

  • It uses attention mechanisms to identify important intermediate teacher-student layer pairs and focuses on aligning their outputs .

  • This computational method enables higher compression of GNNs with minimal accuracy loss, achieving a 1.79% increase in accuracy with a 32.3× compression ratio on certain datasets .

abkD Kinase:

  • abkD refers to a probable serine/threonine-protein kinase in Dictyostelium discoideum.

  • It belongs to the ABC1 family of protein kinases involved in cellular signaling .

  • It functions within biological pathways rather than computational algorithms.

Research Convergence Possibilities:
Despite being separate concepts, there are potential areas where these fields might intersect:

  • Computational modeling of kinase networks:

    • ABKD algorithms could potentially be applied to model complex signaling networks involving abkD and other kinases in Dictyostelium.

    • Graph neural networks could represent protein-protein interactions where abkD participates.

  • Pathway analysis:

    • Knowledge distillation approaches might help identify key regulatory relationships in complex datasets from Dictyostelium experiments.

  • Data interpretation:

    • Machine learning approaches using ABKD principles could be applied to analyze high-dimensional data from experiments involving abkD.

While sharing an acronym is coincidental, both fields represent advanced approaches in their respective domains of computational science and molecular biology.

What are the comparative advantages of using Dictyostelium versus other model organisms for studying abkD function?

Dictyostelium discoideum offers several distinct advantages for studying abkD function compared to other model organisms:

FeatureDictyostelium discoideumS. cerevisiae (Yeast)Mammalian Cell CultureRelevance to abkD Research
Genome complexityLow redundancy, haploidLow redundancy, can be haploidHigh redundancy, diploidSimplified genetic manipulation of abkD
Evolutionary conservationMany genes shared with higher eukaryotesFewer conserved genesHighest conservationabkD function may reflect conserved kinase roles
Developmental processesUnicellular to multicellular transitionLimited differentiationCell-type dependentStudy abkD in both single-cell and developmental contexts
Experimental tractabilityEasy culture, inexpensiveVery easy cultureComplex, expensiveFacilitates large-scale abkD studies
Gene manipulationStraightforward knockout generationVery easyMore challengingSimplified abkD functional analysis
Available genetic toolsExpression constructs, insertional mutant librariesExtensiveExtensive but complexMultiple approaches to study abkD
Recombinant protein toolsDeveloping antibody toolboxExtensiveExtensiveIncreasing resources for abkD detection
Relevant cellular processesPhagocytosis, autophagy, chemotaxisLimited similarity to animal cellsMost physiologically relevantabkD can be studied in physiologically relevant processes

Specific advantages of Dictyostelium for abkD research include:

  • Conserved signaling pathways: Many kinase-regulated pathways in Dictyostelium are conserved in higher organisms, making findings potentially translatable .

  • Unique life cycle: The transition between unicellular and multicellular phases allows study of abkD in both contexts .

  • Simpler system: Lacking the complexity of multiple cell types while maintaining many features of animal cells .

  • Genetic tractability: The haploid genome facilitates generation of knockout mutants to study abkD function .

  • Cost-effectiveness: Inexpensive culture conditions and rapid growth make large-scale experiments feasible .

These characteristics make Dictyostelium particularly valuable for uncovering fundamental roles of abkD that may be conserved across species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.