Recombinant Dictyostelium discoideum Probable tetraspanin tspD (tspD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
tspD; DDB_G0270682; Probable tetraspanin tspD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
tspD
Target Protein Sequence
MVEYLPSTPRYLKVPLIILNVILWLLGLVLVIIGGICVGFFSRFKELQEVGGVSESIKSI SVSLPAGVLSIGIFFMVLTVAGCIVAYKEKMVGLVFYTILMLVLLVVLIGIGGEALTYHN ADIGIEIEDNWKNISYSNQSVVIKKLEQFFECCCFDESDLKLNCTALCPQDDQKNILYNG TFCYDVIFGAVNSKLYLVGSAGVAIGVIELVSLMFALFLIVRLYKSNSYR
Uniprot No.

Target Background

Database Links
Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the structure and expression pattern of tetraspanin TspD in Dictyostelium discoideum?

TspD is one of five tetraspanins (TspA-E) identified in D. discoideum, characterized by four transmembrane domains, a short extracellular loop (EC1), a very short intracellular loop (ICL), and a large extracellular loop (EC2). The protein contains approximately 230 amino acids with a predicted molecular weight of about 25.4 kDa .

Expression analysis shows that TspD is expressed in both vegetative amoebae (to a lesser extent than TspA and TspC) and more abundantly in the multicellular slug stage. This has been confirmed through reverse transcriptase PCRs and supported by expressed sequence tag (EST) data . The full sequence contains 2 introns and is located on chromosome 1 .

Structurally, TspD contains:

  • Four transmembrane domains

  • A modified "CCC" motif in EC2 (compared to the "CCG" motif in human tetraspanins)

  • Four cysteines that form intramolecular disulfide bonds

  • Potential palmitoylation sites adjacent to TM2 and TM4

  • Potential N-glycosylation sites in EC1 and EC2

How does TspD differ from other D. discoideum tetraspanins?

The five D. discoideum tetraspanins share structural similarities but differ in several aspects:

NamePredicted protein size (kDa)"CCG"-motifExpression patternIntronsChromosome
TspA25.5CCKVegetative and slug stages21
TspB25.5CCKAggregation and slug stages21
TspC26.3CCCSlug stage (also vegetative)31
TspD25.4CCCSlug stage (also vegetative)21
TspE26.5CCGSlug stage only15

TspD shows a distinct expression pattern compared to other D. discoideum tetraspanins, being expressed in both vegetative amoebae and the slug stage. Unlike TspC, which has been shown to localize to contractile vacuoles and play a role in osmoregulation, the specific subcellular localization and function of TspD have been less thoroughly characterized .

What are effective protocols for expressing and purifying recombinant TspD for functional studies?

Recombinant TspD can be effectively produced using bacterial expression systems, particularly E. coli, with proper consideration for protein folding and post-translational modifications.

Expression Protocol:

  • Clone the full-length TspD gene (DDB_G0270682) into an expression vector with an N-terminal His-tag

  • Transform into E. coli expression strains optimized for membrane protein expression

  • Induce protein expression at lower temperatures (16-20°C) to enhance proper folding

  • Harvest cells and lyse under native conditions

Purification Methodology:

  • Solubilize membrane fractions with mild detergents (DDM or CHAPS)

  • Purify using immobilized metal affinity chromatography (IMAC)

  • Perform size exclusion chromatography to obtain homogeneous protein

  • Reconstitute in detergent micelles or liposomes for functional studies

The recombinant protein can be stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0. For long-term storage, add 5-50% glycerol as a cryoprotectant and store at -20°C/-80°C in aliquots to avoid repeated freeze-thaw cycles .

How can researchers design knockout experiments to study TspD function?

Based on established methods for D. discoideum genetic manipulation, researchers can apply the following approach to generate TspD deletion strains:

Knockout Strategy:

  • Design homologous recombination constructs targeting the TspD gene

  • Create a disruption cassette by replacing the coding region with a selectable marker (e.g., Blasticidin resistance)

  • Transform D. discoideum cells using electroporation

  • Select transformants with the appropriate antibiotic

  • Verify gene disruption by PCR and Western blotting

Alternative CRISPR-Cas9 Approach:
Recent developments have enabled CRISPR-Cas9 genome editing in D. discoideum, offering a more efficient method:

  • Design sgRNAs targeting the TspD coding sequence

  • Clone sgRNAs into a Cas9-expressing vector adapted for D. discoideum

  • Transform cells and select with appropriate antibiotics

  • Screen clones for successful editing using sequencing

Previous studies have shown that TspD deletion strains exhibit unaltered growth, adhesion, random motility, and development, suggesting potential functional redundancy with other tetraspanins .

What experimental approaches can elucidate TspD's subcellular localization and trafficking?

Several complementary techniques can be employed to determine TspD's subcellular localization and trafficking patterns:

Fluorescent Protein Fusion Approach:

  • Generate constructs expressing TspD fused with GFP or other fluorescent proteins

  • Transform D. discoideum cells and select stable transformants

  • Visualize localization using confocal microscopy

  • Perform co-localization studies with organelle markers (e.g., plasma membrane, endosomes, contractile vacuoles)

Studies with other D. discoideum tetraspanins have employed GFP-tagged constructs to demonstrate localization to the contractile vacuole network . This approach can similarly be applied to TspD.

Antibody-Based Detection:

  • Generate antibodies against peptide sequences derived from TspD's EC2 domain

  • Perform immunofluorescence microscopy to detect endogenous TspD

  • Use these antibodies for Western blotting to confirm expression and molecular weight

Note that previous attempts to detect endogenous TspD using antibodies raised against EC2 peptides were unsuccessful, suggesting potential technical challenges or low endogenous expression levels .

How can researchers investigate the role of TspD in membrane organization and protein-protein interactions?

Tetraspanins are known to form "tetraspanin webs" or tetraspanin-enriched microdomains. To investigate TspD's role in membrane organization:

Proximity-Based Proteomics:

  • Express TspD fused to a proximity-labeling enzyme (BioID or APEX)

  • Allow in vivo biotinylation of proteins in close proximity to TspD

  • Purify biotinylated proteins using streptavidin affinity chromatography

  • Identify interaction partners using mass spectrometry

Co-Immunoprecipitation Studies:

  • Create constructs expressing tagged versions of TspD

  • Perform gentle detergent-based cell lysis to preserve protein-protein interactions

  • Immunoprecipitate TspD complexes using tag-specific antibodies

  • Identify co-precipitated proteins by mass spectrometry or Western blotting

Studies in other organisms have shown that tetraspanins interact with specific transmembrane and cytosolic proteins. For example, in C. elegans, tetraspanins TSP-12 and TSP-14 regulate the recycling of the BMP type II receptor , suggesting potential roles in receptor trafficking that could be explored for TspD.

How does TspD compare functionally to tetraspanins in other organisms?

Tetraspanins are widely conserved across eukaryotes, with various functions in different organisms. Comparative analysis reveals:

Functional Comparisons:

  • In C. elegans, tetraspanins TSP-12 and TSP-14 regulate BMP receptor trafficking and recycling

  • In mammals, tetraspanins regulate various processes including cell adhesion, migration, and signaling

  • D. discoideum TspC functions in osmoregulation through the contractile vacuole network

TspD might share functional similarities with these proteins, particularly in membrane organization and protein trafficking. Research in C. elegans has shown that tetraspanins can function redundantly , which might explain why TspD deletion does not result in obvious phenotypes.

What experimental approaches can determine if TspD functions redundantly with other D. discoideum tetraspanins?

To investigate potential functional redundancy:

Multiple Gene Knockout Strategy:

  • Generate double or triple knockout strains (e.g., tspC/tspD double knockout)

  • Assess phenotypes under various conditions, particularly stress conditions

  • Complement with individual genes to determine specific contributions

Cross-Complementation Studies:

  • Express TspD in tspA or tspC mutant backgrounds

  • Determine if TspD can rescue phenotypes associated with other tetraspanin deletions

  • Create chimeric proteins swapping domains between tetraspanins to identify functional regions

Stress Response Analysis:
Test knockout strains under various stress conditions:

  • Osmotic stress (hypo/hyperosmotic conditions)

  • Nutritional stress

  • Developmental timing and pattern formation

  • Cell adhesion and motility assays

Previous research has shown that tspC knockout cells exhibit defects in coping with hypo-osmotic stress due to contractile vacuole dysfunction . Similar assays could reveal TspD-specific functions or redundant functions with other tetraspanins.

How might TspD contribute to D. discoideum development and pattern formation?

D. discoideum undergoes a complex developmental cycle from single-cell amoebae to multicellular structures, involving pattern formation through cAMP signaling.

Potential Developmental Roles:

  • TspD may regulate cell adhesion or migration during aggregation

  • It could modulate cAMP signaling or receptor trafficking

  • It might function in cell-type differentiation (prespore vs. prestalk cells)

To investigate these possibilities:

  • Analyze TspD expression throughout development using qRT-PCR and Western blotting

  • Examine developmental phenotypes of tspD knockout cells under different conditions

  • Use time-lapse microscopy to track cell movement and aggregation

D. discoideum cells show patterns of cAMP waves during aggregation , and tetraspanins could potentially modulate these patterns by affecting receptor localization or signal transduction.

What proteomics approaches can identify TspD-associated proteins in different developmental stages?

Mass spectrometry-based proteomics can elucidate TspD's changing interaction network during development:

Stage-Specific Proteomics Protocol:

  • Express tagged TspD in D. discoideum cells

  • Harvest cells at different developmental stages (vegetative, aggregation, mound, slug, fruiting body)

  • Immunoprecipitate TspD complexes from each stage

  • Analyze protein composition by LC-MS/MS

  • Compare interactomes across developmental stages

Sample Preparation for Mass Spectrometry:

  • Extract proteins from D. discoideum cells using appropriate buffers

  • Perform in-solution or in-gel digestion with trypsin

  • Analyze digested peptides using LC-MS/MS

  • Identify proteins using D. discoideum protein databases

  • Quantify changes in protein abundance across conditions

This approach could reveal how TspD's interactions change during development and provide insights into its potential developmental functions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.