Recombinant Dictyostelium discoideum Probable tetraspanin tspE (tspE)

Shipped with Ice Packs

In Stock

Cat. No.

BT2062746

Source

in vitro E.coli expression system

Synonyms

tspE; DDB_G0291177; Probable tetraspanin tspE

Quick Inquiry

Description

Molecular Characterization of tspE

D. discoideum tspE is encoded by the gene DDB_G0291177 on chromosome 5 and belongs to a family of five tetraspanins (TspA-E) . Key features include:

Feature	Detail
Protein length	231 amino acids (predicted molecular weight: ~26.5 kDa)
Structural motifs	Four transmembrane domains, short extracellular loops (EC1/EC2), and a conserved "CCG" motif in EC2
Post-translational modifications	Potential N-glycosylation sites in EC1 and EC2
Gene expression	Detected in multicellular slug stages but not in vegetative amoebae

The "CCG" motif distinguishes tspE from other D. discoideum tetraspanins (e.g., TspA-D have "CCK/Y/C" motifs), aligning it more closely with metazoan tetraspanins .

Recombinant Production and Purification

Recombinant tspE is produced in heterologous systems for research applications:

Research Applications and Findings

Recombinant tspE facilitates studies on tetraspanin functions and interactions:

Localization: GFP-tagged Dictyostelium tetraspanins (including tspE homologs) localize to contractile vacuoles, suggesting roles in osmoregulation .
Functional insights: While tspE deletion strains show no overt developmental defects, its structural conservation with human tetraspanins (e.g., CD9/CD63) implies potential roles in membrane dynamics .
Biochemical tools: Recombinant tspE is used in ELISA and Western blotting to generate antibodies or study protein-protein interactions .

Table 3. Tetraspanin Family in D. discoideum

Name	Gene ID	Chromosome	CCG Motif	Expression Stage
TspA	DDB_G0269110	1	CCK	Vegetative, slug
TspB	DDB_G0269872	1	CCK	Slug
TspC	DDB_G0270986	1	CCC	Vegetative, slug
TspD	DDB_G0270682	1	CCC	Vegetative (low), slug
TspE	DDB_G0291177	5	CCG	Slug

TspE’s unique CCG motif may enable interactions distinct from other family members, though functional studies remain limited .

Future Directions

Recombinant tspE provides a platform to explore:

Evolutionary conservation of tetraspanin functions across eukaryotes.
Structural basis of membrane protein assembly in contractile vacuoles.
Potential therapeutic targeting in diseases involving tetraspanins, such as cancer or parasitic infections .

Product Specs

Form

Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, kindly indicate it in your order remarks, and we will prepare it accordingly.

Lead Time

Delivery time may vary depending on the purchasing method or location. For specific delivery timelines, please consult your local distributors.
Please note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional fees may apply.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Reconstitution

We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.

Shelf Life

Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Storage Condition

Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.

Tag Info

The tag type will be determined during the manufacturing process.

The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing it.

Synonyms

tspE; DDB_G0291177; Probable tetraspanin tspE

Buffer Before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Datasheet

Please contact us to get it.

Expression Region

1-231

Protein Length

full length protein

Species

Dictyostelium discoideum (Slime mold)

Target Names

tspE

Target Protein Sequence

MTFVDNFEFNQNTPRLVRGPFIILNSIIFSLSFILLCSTGIIIYYLNEYYLVKDLTIPLG SFILSAYMVITTIVGGIAIWKKKLGLHLTFMVFLVVLIVCLVGVSAKMIVDSGNPEKLQH KIENIWYKVGNYQHHSKHYHHGIIEIIEKHHRCCGWSKEIEGNYCVHFNRRESGHGYCAP YVEKSVESILKYLGYYGIVLSVIELILLILSGFFLLKTNKNVKSKSFILQD

Uniprot No.

Q54F08

Target Background

Database Links

KEGG: ddi:DDB_G0291177

STRING: 44689.DDB0252568

Protein Families

Tetraspanin (TM4SF) family

Subcellular Location

Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected

Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Name*

Email*

Phone

Country

Source

Quantity&Size*

Product Name

Message

Recombinant Dictyostelium discoideum Probable tetraspanin tspE (tspE)

Description

Molecular Characterization of tspE

Recombinant Production and Purification

Research Applications and Findings

Table 3. Tetraspanin Family in D. discoideum

Future Directions

Product Specs

Target Background

Quick Inquiry

Category

Service