Recombinant Dictyostelium discoideum Probable zinc transporter protein DDB_G0269332 (DDB_G0269332)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preference in the order notes and we will fulfill your request.
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preference in the order notes and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. For specific delivery estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For ease of access, we recommend briefly centrifuging the vial prior to opening to settle the contents. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life of our products depends on various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. For multiple uses, aliquotting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us and we will prioritize its development.
Synonyms
DDB_G0269332; Probable zinc transporter protein DDB_G0269332
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-614
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0269332
Target Protein Sequence
MSDINSNSYDPYHHPQQHQQESQYHPQQQQQQQQQQQQQQEYYNQQHQQESQYQQQSPPQ
QQYDNHQHHQQDLNQAHNSGHGRSHNSGHGHSHGNNYSGLPHLRTQVGHAQPYFSSYNEL
NNSGDISNSNNNNNNNNQYNYNNNNNNNNYNNNINNNQFNSSVYNNNNNNNNNNNNEFSI
DGKSGITIKHLLNNLNRDSDAKKLAAWISVMLVFTIYEIFYGAYLESLGLVSDGFHALFD
CIGMGIALLAMLVGKRGISNQEYTYGYDRWEVLGTFSNGCFLLFVSFFLFLESIERLLEP
PHIHNHGRVMSLATISLIINIVGVLFFKQKSNERKQQSSIRSENLLTISHHILVDSCTSL
GVILSSLVGQAFGLEISDSLISIIIACIIVYNALPICIKTSAILLQTTPDQLKININNAI
KDILVMEGVIDVTDKHFWSHSPGNIIATVNLLTKKNCDDFTLTQSIRNRLSFVQDLTIQL
DKEGKHNSHSHGGAHHHPHEHKEDKKSHNHSHGHNHGHSHGHSHGGNDDHEHGENCDEEH
EPVPKYQVQPTSPFSSHYTDIHSNNTPIPLYKSEQDDEDDEDDYDHDEHHHDHDHDEHHH
GHSHNSSHSHAHNH
Uniprot No.
Target Background
Function
This protein may be involved in the transport of zinc from the cytoplasm to either intracellular organelles or extracellular spaces.
Database Links
KEGG: ddi:DDB_G0269332
STRING: 44689.DDB0266645
Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
