Recombinant Dictyostelium discoideum Protein KRTCAP2 homolog (DDB_G0286759)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are standardly shipped with blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
DDB_G0286759; Protein KRTCAP2 homolog; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit KCP2; Oligosaccharyl transferase subunit KCP2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0286759
Target Protein Sequence
MASRQPSEGSTVLISLILWVIIFALLNIGSNFFRSSEGATILGGFVGSFLFFLQMTFIGA IKRDVKLLETVLAVIITAMISSSVHRVSGTTSIIFSIGWIFYLNHASTKIYSKLEETNTV VSGKKRK
Uniprot No.

Target Background

Function
This protein is a subunit of the oligosaccharyltransferase (OST) complex. The OST complex catalyzes the transfer of a defined glycan (Glc3Man9GlcNAc2 in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This is the initial step in protein N-glycosylation. N-glycosylation occurs co-translationally, and the complex associates with the Sec61 complex at the translocon, facilitating protein translocation across the endoplasmic reticulum (ER). All subunits are necessary for optimal enzyme activity.
Database Links
Protein Families
KRTCAP2 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the KRTCAP2 homolog (DDB_G0286759) in Dictyostelium discoideum?

The KRTCAP2 homolog (DDB_G0286759) in Dictyostelium discoideum is a 127-amino acid protein also known as "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit KCP2" or "Oligosaccharyl transferase subunit KCP2" with UniProt ID Q54L98 . This protein contains a transmembrane domain and is predicted to function as part of the oligosaccharyl transferase complex involved in protein glycosylation pathways. The full amino acid sequence is: "MASRQPSEGSTVLISLILWVIIFALLNIGSNFFRSSEGATILGGFVGSFLFFLQMTFIGAIKRDVKLLETVLAVIITAMISSSVHRVSGTTSIIFSIGWIFYLNHASTKIYSKLEETNTV VSGKKRK" . Structurally, this protein exhibits conserved domains typically associated with the keratinocyte-associated protein 2 family, though its exact cellular functions in Dictyostelium are still being elucidated through ongoing research. The protein is considered a homolog to human KRTCAP2, suggesting potential functional conservation across evolutionary distance that makes it valuable for comparative studies.

Why is Dictyostelium discoideum an effective model organism for studying KRTCAP2 homologs?

Dictyostelium discoideum provides an exceptional model system for studying KRTCAP2 homologs due to several key advantages in experimental tractability and biological relevance. The organism has been fully sequenced, revealing numerous orthologs of human genes associated with various cellular processes and disorders, including those involved in protein glycosylation pathways . The genetic tractability of D. discoideum allows for straightforward manipulation of genes including KRTCAP2 homolog, enabling researchers to create knockout, knockdown, or overexpression strains for comprehensive phenotypic analysis . This amoeba's unique life cycle, transitioning from unicellular to multicellular stages, offers opportunities to study protein function in both individual cell behavior and collective developmental processes. Additionally, D. discoideum's relatively simple genome compared to mammalian systems reduces genetic redundancy issues, making it easier to attribute observed phenotypes to specific genetic modifications. The conservation of many fundamental cellular processes between D. discoideum and higher eukaryotes further validates findings from this model for translation to human biology, as demonstrated by the functional homology observed between other D. discoideum proteins and their human counterparts .

What are the optimal storage and handling conditions for recombinant KRTCAP2 homolog protein?

Recombinant KRTCAP2 homolog protein requires specific storage and handling conditions to maintain its structural integrity and biological activity. The lyophilized protein powder should be stored at -20°C to -80°C upon receipt, with aliquoting necessary to avoid repeated freeze-thaw cycles that can compromise protein stability . Before opening, the vial should be briefly centrifuged to ensure the contents are at the bottom of the tube. For reconstitution, it is recommended to use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL . The addition of glycerol to a final concentration of 5-50% (with 50% being the default recommendation) provides cryoprotection for long-term storage at -20°C or -80°C . Working aliquots can be maintained at 4°C for up to one week, but extended storage at this temperature is not advised due to potential protein degradation . The reconstituted protein is typically stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0, which helps maintain protein stability . Researchers should consider the addition of protease inhibitors if conducting extended experiments, especially when working with cellular extracts that may contain endogenous proteases.

How can I verify the expression and purity of recombinant KRTCAP2 homolog?

Verification of expression and purity of recombinant KRTCAP2 homolog requires a multi-faceted analytical approach to ensure experimental reliability. SDS-PAGE analysis serves as the primary verification method, with commercial preparations typically demonstrating greater than 90% purity . When running SDS-PAGE, researchers should observe a distinct band at approximately 14-15 kDa corresponding to the 127-amino acid protein plus the His-tag fusion element. Western blotting using anti-His antibodies provides additional confirmation of proper expression and can detect even small amounts of the target protein in complex mixtures. Mass spectrometry analysis offers the most definitive identification, allowing researchers to confirm the exact molecular weight and, through tryptic digestion and peptide mapping, verify the amino acid sequence matches the expected composition for KRTCAP2 homolog. For functional verification, researchers should consider developing activity assays relevant to the protein's predicted glycosyltransferase-related functions. Additionally, circular dichroism spectroscopy can provide valuable information about the protein's secondary structure, helping to confirm proper folding which is essential for biological activity.

What experimental approaches are recommended for investigating KRTCAP2 homolog's role in cellular glycosylation pathways?

Investigating KRTCAP2 homolog's role in cellular glycosylation pathways requires an integrated experimental strategy combining genetic, biochemical, and cellular approaches. Researchers should begin with CRISPR-Cas9 gene editing to generate knockout or knockdown D. discoideum strains, followed by comprehensive phenotypic characterization including growth rate analysis, development progression tracking, and morphological assessment during the multicellular phase . Biochemical interaction studies using co-immunoprecipitation with other known components of the oligosaccharyl transferase complex will help elucidate protein-protein interactions and complex formation dynamics. Mass spectrometry-based glycoproteomics should be employed to profile N-linked and O-linked glycan structures in wild-type versus mutant strains, enabling identification of specific glycosylation events dependent on KRTCAP2 function. Subcellular localization studies using fluorescent protein tagging and confocal microscopy can determine whether the protein localizes to the endoplasmic reticulum as expected for components of the glycosylation machinery, similar to the approach used for presenilin proteins in D. discoideum . Complementation studies expressing the human KRTCAP2 in knockout D. discoideum strains would test functional conservation between species. Additionally, researchers should implement glycosylation-specific assays using lectins or glycan-binding proteins to detect alterations in cell surface or secreted glycoproteins resulting from KRTCAP2 manipulation.

How does the structure-function relationship of KRTCAP2 homolog inform its potential role in protein complex formation?

The structure-function relationship of KRTCAP2 homolog provides critical insights into its role in protein complex formation, particularly within the oligosaccharyl transferase machinery. Sequence analysis reveals that the 127-amino acid KRTCAP2 homolog contains hydrophobic transmembrane domains characteristic of membrane-integrated glycosyltransferase complex components . These transmembrane regions likely anchor the protein within the endoplasmic reticulum membrane, positioning it optimally for interaction with other components of the glycosylation machinery. Comparative sequence analysis between D. discoideum KRTCAP2 homolog and its counterparts in other species can identify evolutionarily conserved residues that may represent functionally critical domains for protein-protein interactions or catalytic functions. The presence of the protein in recombinant form allows for biophysical characterization through techniques such as circular dichroism spectroscopy, which can determine secondary structure elements important for proper folding and function. Site-directed mutagenesis targeting conserved residues followed by functional assays would establish which amino acids are essential for complex formation and activity. Co-expression studies with other oligosaccharyl transferase components would determine assembly dependencies and identify whether KRTCAP2 serves as a nucleation point or peripheral component in complex formation, similar to studies conducted with presenilin proteins in D. discoideum .

What are the implications of studying KRTCAP2 homolog for understanding human neurological disorders?

Studying KRTCAP2 homolog in D. discoideum offers significant implications for understanding human neurological disorders through several interconnected pathways related to protein processing and cellular homeostasis. As a component of the glycosylation machinery, KRTCAP2 may influence protein folding and quality control systems that are frequently compromised in neurodegenerative conditions like Alzheimer's and Parkinson's diseases . Disruptions in protein glycosylation are increasingly recognized as contributing factors to proteostasis defects that can trigger protein aggregation and neuronal dysfunction in various neurological disorders. The conservation of glycosylation pathways between D. discoideum and humans provides a simplified yet relevant system to explore these processes without the complexity of mammalian models . Research in D. discoideum has already established precedent for studying neurological disease-related proteins, including successful expression of human proteins like α-synuclein and Tau in this model organism to investigate toxicity mechanisms . The ability to express human KRTCAP2 in D. discoideum knockout strains could reveal whether dysfunction in this protein contributes to cellular phenotypes relevant to neurodegeneration. Additionally, if KRTCAP2 influences mitochondrial function through its effects on protein processing, it may relate to mitochondrial dysfunction observed in many neurodegenerative disorders, similar to the effects seen with other D. discoideum proteins like DJ-1 .

How can I design experiments to investigate KRTCAP2 homolog interactions with the presenilin pathway in D. discoideum?

Designing experiments to investigate KRTCAP2 homolog interactions with the presenilin pathway requires a systematic approach leveraging D. discoideum's experimental advantages. Begin by generating double knockout strains lacking both KRTCAP2 homolog and presenilin genes (PsenA/PsenB) to assess potential synergistic effects on development, cell signaling, and protein processing pathways . Implement co-immunoprecipitation assays using tagged versions of both proteins to determine whether physical interactions occur between KRTCAP2 homolog and presenilin components. Fluorescence microscopy with dual-labeled proteins can visualize potential co-localization in cellular compartments, particularly the endoplasmic reticulum where presenilin components have been shown to localize in D. discoideum . Employ proximity ligation assays to detect and quantify protein-protein interactions in situ with higher sensitivity than conventional co-localization studies. Analyze glycosylation profiles of known γ-secretase substrates in wild-type versus KRTCAP2 knockout strains to determine whether KRTCAP2-mediated glycosylation influences substrate recognition or processing by the presenilin complex. Create rescue experiments expressing human presenilin in double mutant backgrounds to test whether the functional relationship between these proteins is evolutionarily conserved, similar to previous studies demonstrating that human Psen1 can rescue developmental phenotypes in D. discoideum presenilin mutants . Additionally, assess whether KRTCAP2 mutation affects the auto-proteolytic activity of presenilin proteins, which has been demonstrated to occur in D. discoideum .

What purification strategies optimize yield and activity of recombinant KRTCAP2 homolog?

Optimizing purification strategies for recombinant KRTCAP2 homolog requires careful consideration of the protein's membrane-associated nature and functional requirements. For His-tagged constructs, immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins provides effective initial capture, but researchers should optimize imidazole concentration gradients to balance between purity and yield . Following IMAC, size exclusion chromatography is recommended to remove aggregates and improve homogeneity, which is critical for structural studies and consistent functional assays. When purifying KRTCAP2 from membrane fractions, detergent selection becomes crucial—mild non-ionic detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin help maintain native conformation while solubilizing the protein from lipid environments. Throughout the purification process, maintaining a stable pH (typically 8.0) and including glycerol (5-50%) helps preserve protein stability and prevent aggregation . For maximum purity, ion exchange chromatography can be implemented as a polishing step, taking advantage of KRTCAP2's predicted isoelectric point. Researchers should monitor protein quality at each purification stage using analytical techniques such as SDS-PAGE, Western blotting, and dynamic light scattering to assess purity and aggregation state . The final purified protein should be stored in a stabilizing buffer containing trehalose (6%) which helps maintain protein integrity during freeze-thaw cycles and long-term storage . Additionally, conducting activity assays before and after each purification step can help identify conditions that preserve functional activity.

What analytical techniques are most informative for characterizing KRTCAP2 homolog structure and function?

Comprehensive characterization of KRTCAP2 homolog structure and function requires a multi-technique analytical approach tailored to its membrane protein characteristics. Circular dichroism spectroscopy provides valuable data on secondary structure content, helping confirm proper protein folding and stability under various buffer conditions. For detailed structural analysis, X-ray crystallography or cryo-electron microscopy may be attempted, though successful crystallization of membrane proteins requires extensive optimization of detergent and lipid conditions. Hydrogen-deuterium exchange mass spectrometry offers insights into protein dynamics and solvent-accessible regions without requiring crystallization. Functional characterization should begin with binding assays to identify interactions with other oligosaccharyl transferase complex components using techniques such as surface plasmon resonance or microscale thermophoresis. Glycosyltransferase activity can be assessed using specialized assays that monitor the transfer of glycan moieties to acceptor peptides or proteins. Cellular assays comparing wild-type and KRTCAP2-deficient D. discoideum can evaluate phenotypic effects on development, cell morphology, and chemotaxis, which have been informative for other D. discoideum proteins related to human disease models . For in-depth functional studies, researchers should consider comparative analysis between various KRTCAP2 homologs from different species, which can reveal evolutionarily conserved functional domains and species-specific adaptations . Additional structural insights can be gained from in silico approaches such as molecular modeling and molecular dynamics simulations, especially when informed by experimental data from limited proteolysis or cross-linking mass spectrometry.

How should I design knockout and complementation experiments to study KRTCAP2 homolog function in D. discoideum?

Designing effective knockout and complementation experiments for KRTCAP2 homolog requires strategic planning to maximize informative outcomes. Begin by generating a complete gene knockout using CRISPR-Cas9 targeting or homologous recombination approaches, which have been successfully applied to other D. discoideum genes . Verify knockout efficiency through genomic PCR, RT-PCR, and Western blotting to confirm complete absence of the target protein. Phenotypic characterization should comprehensively assess growth rates in axenic culture, development timing and morphology upon starvation, cell-cell adhesion, and chemotactic responses to cAMP gradients. These phenotypic assays have successfully revealed functions of other proteins in D. discoideum, such as the Roco family kinases . For complementation studies, create expression constructs containing either the native D. discoideum KRTCAP2 homolog or the human KRTCAP2 gene under control of an appropriate promoter (constitutive or inducible). Transform these constructs into the knockout strain and select stable transformants for phenotypic rescue assessment. Include protein variants with point mutations in conserved domains to map structure-function relationships, similar to studies conducted with presenilin proteins where specific aspartic acid residues were mutated to assess their contribution to function . For temporal control, consider using inducible expression systems that allow protein expression at specific developmental stages. Additionally, implement chimeric proteins containing domains from different species' KRTCAP2 homologs to identify which regions confer species-specific functions versus universally conserved activities, providing insights into evolutionary conservation of protein function.

What are the emerging research trends involving KRTCAP2 homolog and related proteins?

Emerging research involving KRTCAP2 homolog and related proteins is expanding in several promising directions that integrate diverse biological disciplines. Systems biology approaches are increasingly mapping protein interaction networks encompassing KRTCAP2 homologs across species, revealing previously unrecognized connections to cellular pathways beyond glycosylation. The application of cryo-electron microscopy to resolve the structure of oligosaccharyl transferase complexes including KRTCAP2 components is advancing understanding of how these multiprotein assemblies coordinate their activities in the endoplasmic reticulum membrane. Increasing evidence suggests potential roles for KRTCAP2 and related proteins in cellular stress responses and protein quality control, connecting them to broader cellular homeostasis mechanisms relevant to neurodegenerative disease models being studied in D. discoideum . Comparative genomic analyses across the evolutionary spectrum are uncovering patterns of conservation and specialization in KRTCAP2 homologs that may reflect adaptation to specific cellular environments or functions. The integration of D. discoideum models with mammalian cell culture and organismal studies is creating translational research pathways where discoveries in the amoeba model can be validated and extended in more complex systems. Advanced gene editing technologies are enabling more precise temporal and spatial control of KRTCAP2 expression, allowing researchers to dissect stage-specific functions during development or under specific cellular stresses. Together, these research trends are positioning KRTCAP2 homolog studies at the intersection of fundamental glycobiology, protein quality control, and disease-relevant cellular mechanisms.

How can findings from KRTCAP2 homolog research contribute to therapeutic strategies for human diseases?

Findings from KRTCAP2 homolog research in D. discoideum have significant potential to contribute to therapeutic strategies for human diseases through multiple translational pathways. By elucidating the fundamental role of KRTCAP2 in protein glycosylation and quality control, researchers can identify critical nodes in these pathways that may be targeted pharmacologically to modulate protein processing in diseases characterized by protein misfolding or aggregation . The simplified genetic background of D. discoideum provides an ideal screening platform for identifying small molecules that modulate KRTCAP2 function or compensate for its loss, potentially revealing drug candidates for further development in mammalian models. If KRTCAP2 dysfunction contributes to specific glycosylation defects relevant to neurological disorders, enzyme replacement or substrate reduction therapies might be developed targeting these pathways, similar to approaches used for other glycosylation disorders. The D. discoideum model allows for rapid phenotypic screening of compound libraries against KRTCAP2-related phenotypes, potentially identifying therapeutic candidates that might be missed in more complex systems. Structure-function studies of KRTCAP2 can inform rational drug design efforts targeting specific protein domains or interaction surfaces. Additionally, if KRTCAP2 influences mitochondrial function through its effects on protein processing pathways, it may provide new targets for addressing the mitochondrial dysfunction observed in neurodegenerative conditions, similar to findings with other D. discoideum proteins like DJ-1 that influence mitochondrial respiration . By integrating findings from this model organism with human genetics and clinical observations, researchers can develop more precise therapeutic hypotheses targeting specific disease mechanisms related to protein processing and cellular homeostasis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.