Recombinant Dictyostelium discoideum Protein odr-4 homolog (DDB_G0283829)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
DDB_G0283829; Protein odr-4 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-456
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0283829
Target Protein Sequence
MIINSNIKITLEERSNKLEQSHIEIGLLIGQESEISEQQTFVLGLFPTPLNISNTDDDNN NKPINIDSISSIDKEWILEYCHQVNIMLYGGIDIVGIYMIIPDSDTLNEKNNESFIMKLL KSIHTIINSKSLQFISYSKKTGLINGKATNSTQLYRLKSTEIKVINNLENEFLSLHCILP IDIKLKSKNGMISFENLKKDIIEIFENQLFKESTLLIENEFVSGNEIISQQFKSKSKLNI DLLINQLDSISTSSLEFNFNNNNNTHCIAYIHQLEQIKTAFKFIKKDIIKSVESRFDLLF NEISSNNNNNDNDQDNIKLSKESPILELPRRVNIQWLSNKISICDYLSSNGTIDDCYKII NDLLQITSPKINSIESSKNNNNNNNNNNNNNNNNNNNNSKLSNKKENNEIKENKDTQSNL TKSTSQQQTKQTNNSYLIIIISVLVLMVAFYFKFFV
Uniprot No.

Target Background

Function
Plays a potential role in the trafficking of a subset of G-protein coupled receptors.
Database Links
Protein Families
ODR-4 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Dictyostelium discoideum Protein odr-4 homolog?

Protein odr-4 homolog in Dictyostelium discoideum (DDB_G0283829) is a protein encoded in the genome of the social amoeba Dictyostelium discoideum. It is categorized as an "organism-gene" in the Protein Ontology database and is a child of the parent protein odr-4 (PR:000011605) . This protein represents one of many conserved genes in Dictyostelium that have homologs in other organisms, making it valuable for comparative studies across species.

Why is Dictyostelium discoideum an important model organism for studying odr-4?

Dictyostelium discoideum offers distinct advantages for studying cell biological processes that common yeast models do not undertake and for investigating genes that yeasts do not possess . Its haploid nature simplifies genetic manipulation, and the organism is readily transformable, supporting sophisticated molecular genetic techniques . Dictyostelium bridges an evolutionary gap, serving as a model amoebozoan that can provide insights relevant to both simple and complex organisms . Its genome encodes many homologs of human disease genes, including those implicated in neurodegenerative disorders .

What are the recommended approaches for genetic manipulation of odr-4 homolog in Dictyostelium?

Gene disruption via homologous recombination is a highly efficient technique for studying the odr-4 homolog in Dictyostelium. This approach works with an efficiency sometimes as high as 90%, making it ideal for functional studies . For serial gene disruptions in related gene families, the Cre-loxP system allows for the recycling of selection markers, enabling multiple rounds of gene targeting in a single strain .

When studying an essential gene like odr-4 homolog that might be crucial for cellular growth, alternative approaches should be considered. Researchers can employ:

  • Antisense constructs under regulatable promoters

  • Dominant negative constructs

  • RNA interference (RNAi) for transient knockdown

  • Inducible expression systems to control gene activity temporally

Each approach has specific advantages depending on the research question being addressed .

How can protein-protein interactions of odr-4 homolog be effectively studied?

Based on methodologies used for similar proteins in Dictyostelium, researchers can employ multiple complementary approaches:

  • Co-immunoprecipitation (Co-IP): This technique has been successfully used to identify protein complexes in Dictyostelium, as demonstrated with ISWI1 and ICOP proteins . For odr-4 homolog studies, researchers can:

    • Create tagged versions (HA, GFP) of the odr-4 homolog

    • Perform reciprocal co-IPs to assess interactions

    • Use mass spectrometry for unbiased identification of binding partners

  • Recombinant protein expression: Express the odr-4 homolog using GST or His tags in bacterial systems for in vitro binding assays .

  • Structural prediction tools: Tools like AlphaFold2 can be used to predict potential interaction interfaces, though confidence may vary based on sequence conservation .

What experimental design types are most appropriate for studying odr-4 homolog function?

When designing experiments to investigate odr-4 homolog function, researchers should consider these three experimental design approaches:

  • Independent measures design: This approach uses different experimental groups for each condition being tested. For studying odr-4 homolog, this might involve comparing wild-type cells with knockout mutants or testing different mutant versions of the protein in separate cell lines .

  • Repeated measures design: This design uses the same experimental units across different conditions, which can be useful when studying the effects of odr-4 homolog under various stressors or developmental stages in the same cell population .

  • Matched pairs design: This approach matches experimental units based on relevant characteristics. For odr-4 homolog studies, this might involve pairing cell lines with similar expression levels of interacting proteins or matching developmental timepoints across different genetic backgrounds .

The choice of design depends on the specific research question, available resources, and the nature of the expected effects. For investigating developmental roles of odr-4 homolog, a repeated measures design might be most appropriate to track changes across the Dictyostelium life cycle.

How do knockout versus knockdown approaches affect interpretation of odr-4 homolog function?

Researchers should be aware of potential discrepancies between knockout and knockdown phenotypes when studying odr-4 homolog, similar to what has been observed with DJ-1 in Dictyostelium. In DJ-1 studies, complete deletion resulted in growth defects without mitochondrial dysfunction, while transient knockdown slightly increased mitochondrial respiration . These conflicting results might be attributed to genetic compensation mechanisms that occur in knockout strains but not in knockdown models .

When designing experiments for odr-4 homolog:

  • Include both knockout and knockdown approaches when possible

  • Consider temporal aspects of gene function (acute versus chronic loss)

  • Investigate potential compensatory pathways that might be activated specifically in knockout models

  • Examine phenotypes under different stress conditions, as gene function may only become apparent under specific cellular stresses

What can evolutionary analysis reveal about odr-4 homolog function?

Evolutionary analysis can provide valuable insights into odr-4 homolog function. Dictyostelium occupies an important evolutionary position as an amoebozoan, bridging the gap between unicellular and multicellular organisms . Researchers should consider:

  • Comparative genomics across the four sequenced Dictyostelid genomes to identify conserved motifs in odr-4 homologs

  • Analysis of selection pressures on different domains of the protein

  • Identification of co-evolved gene networks that might functionally interact with odr-4

  • Cross-species complementation studies to test functional conservation

Interestingly, cross-kingdom homology is sometimes sufficiently strong for a Dictyostelium ortholog to provide information directly relevant to its metazoan counterparts, as demonstrated with STAT proteins .

How might the odr-4 homolog contribute to cellular processes in Dictyostelium?

Based on studies of other conserved proteins in Dictyostelium, the odr-4 homolog might participate in fundamental cellular processes. Drawing parallels with other characterized proteins, researchers should investigate:

  • Developmental regulation: The odr-4 homolog may play a role during the transition from unicellular to multicellular stages, similar to how ISWI1 and ICOP proteins function at specific stages during new MAC development .

  • Complex formation: The protein might function as part of a larger protein complex, similar to ISWI1 and ICOP paralogs that form complexes during autogamy .

  • Stress response pathways: Like DJ-1, which showed different functions under oxidative stress compared to normal conditions, odr-4 homolog might have stress-specific roles .

  • Chemotaxis and cell motility: Given Dictyostelium's robust chemotactic abilities, and that many conserved proteins contribute to this process, odr-4 homolog might participate in sensing or responding to environmental cues .

How should researchers approach conflicting data regarding odr-4 homolog function?

When faced with conflicting data about odr-4 homolog function, researchers should:

  • Examine experimental conditions: Function may vary under different stress conditions, as seen with DJ-1 which exhibited different behaviors under oxidative stress versus normal conditions .

  • Consider genetic background effects: Check for potential genetic compensation mechanisms that might differ between acute (knockdown) and chronic (knockout) loss of gene function .

  • Validate with multiple approaches: Combine genetic, biochemical, and cell biological methods to build a more complete picture of protein function.

  • Investigate developmental timing: The function of odr-4 homolog might vary across different stages of Dictyostelium's life cycle, similar to how ISWI1 and ICOP paralogs show stage-specific localization .

  • Protein domain analysis: Examine whether specific domains contribute differently to protein function, similar to how mutation studies of the GxD signature in ICOP proteins revealed domain-specific contributions to ISWI1 interaction .

What bioinformatic approaches are recommended for studying odr-4 homolog?

For comprehensive bioinformatic analysis of odr-4 homolog, researchers should employ:

  • Structural prediction: Tools like AlphaFold2 can predict protein structure, though results may have varying confidence levels depending on sequence conservation . For odr-4 homolog, focus on highly conserved domains for more reliable predictions.

  • Interaction network analysis: Predict potential protein-protein interactions based on co-expression data and known interaction partners of odr-4 homologs in other species.

  • Domain conservation mapping: Identify highly conserved domains across species, which often indicate functional importance. Less conserved regions might represent species-specific adaptations.

  • Expression analysis: Utilize RNA-seq data to examine expression patterns of odr-4 homolog across different developmental stages and stress conditions, similar to the approach used to validate knockdown efficiency in ICOP studies .

  • Off-target prediction: When designing genetic manipulation experiments, use tools like those available on ParameciumDB to predict potential off-target effects of RNAi constructs .

What experimental controls are critical for validating odr-4 homolog function?

Based on experimental approaches used for similar proteins in Dictyostelium, critical controls should include:

  • Non-transformed wild-type cells: Essential for establishing baseline behavior and validating the specificity of antibodies or other detection methods .

  • Single transformants: When investigating protein interactions, single transformant controls help validate the specificity of co-immunoprecipitation results .

  • Complementation controls: Re-introducing wild-type odr-4 homolog into knockout strains should rescue phenotypes if they are specifically due to loss of this protein.

  • Domain mutation controls: Creating specific domain mutations rather than complete knockouts can help pinpoint functional regions, similar to the GxD signature studies in ICOP proteins .

  • RNAi efficiency validation: When using knockdown approaches, RNA-seq should be used to confirm target gene reduction and assess potential off-target effects, especially when studying gene families with sequence similarity .

What emerging technologies could enhance the study of odr-4 homolog?

Future research on odr-4 homolog could benefit from:

  • CRISPR-Cas9 genome editing: While traditional homologous recombination works well in Dictyostelium, CRISPR technologies might offer more precise and efficient editing capabilities.

  • Proteomics approaches: Advanced mass spectrometry techniques could identify post-translational modifications and interaction partners of odr-4 homolog under different conditions.

  • Live-cell imaging: Advanced microscopy techniques could track odr-4 homolog localization and dynamics during development and stress responses.

  • Multi-omics integration: Combining transcriptomics, proteomics, and metabolomics data could provide a systems-level understanding of odr-4 homolog function.

How can findings from Dictyostelium odr-4 homolog research be translated to human health applications?

Given Dictyostelium's value as a model for human disease genes:

  • The function of odr-4 homolog in Dictyostelium might provide insights into the role of related proteins in human cells, potentially revealing conserved mechanisms relevant to human diseases .

  • Structural studies of Dictyostelium odr-4 homolog could inform drug design targeting human homologs, similar to how Dictyostelium STATa provided insights into the general mechanism of STAT action despite cross-kingdom differences .

  • High-throughput screens using Dictyostelium odr-4 homolog mutants could identify small molecules that rescue phenotypes, potentially leading to therapeutic approaches for human diseases involving related proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.