Recombinant Dictyostelium discoideum Protein P80 (p80)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes if needed. We will accommodate your request whenever possible.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes if needed. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping is available upon request but incurs additional charges. Please contact us in advance to arrange this.
Note: Standard shipping includes blue ice packs. Dry ice shipping is available upon request but incurs additional charges. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Note: The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
p80; DDB_G0287297; Protein P80; Endosomal membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-530
Protein Length
Full Length of Mature Protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
p80
Target Protein Sequence
QVDCVTNSSDASCTNFQYPLANITADINNLCGSMPYMPVCTIQQSCNQESSTSGICDPFS
ILGDSCLHDMPGMSGCNNFKKLCASGSVVEQCSTVDSVTDLPTTMKMWANIKSICNEMTM
TGCEKCTILNATCDVLTVYSTLCLAMPEMGQCANWTQMCASSGNMASSPISSGICTDEPT
PATDCFTNPSDPSCADYVYTAANANADILNLCKSMPYMTVCSIQKSCNQESSTSGICAPF
SILGDSCLHDMPGMNGCSNFKKLCASGSVVEQCSSVDSISNLPTTMQLFAGIKSICTEMA
MDGCEKCSGNSPTTTCDVLPVYSSLCMAMPDMSQCANWTKMCSSSGQLYNSQITSDYCVA
SVADAVPIMRMYFHTGILDYILFKSWVPRTDRQFAGSWFAIFFFAIFFELEKTLRSILEK
RWTPNKKDSEDNNLINSSFLSGSYPKFSYRDIIRGCLHAIELTCSYALMLVAMTFNVALF
FAVIAGVLVGNILFGRYRNYTPRVTCCE
Uniprot No.
Target Background
Database Links
KEGG: ddi:DDB_G0287297
STRING: 44689.DDB0191340
Protein Families
SLC31A transporter family
Subcellular Location
Late endosome membrane; Single-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
