Recombinant Dictyostelium discoideum Protein transport protein got1 homolog (golt1)

Shipped with Ice Packs
In Stock

Description

Proposed Functional Role

While no peer-reviewed studies directly characterize GOLT1’s function in D. discoideum, commercial descriptions suggest it is involved in protein transport, potentially linking it to Golgi-mediated trafficking. This aligns with broader research on D. discoideum as a model for studying eukaryotic protein secretion and membrane dynamics .

Hypothetical Mechanisms

  • Golgi-ER Trafficking: As a Golgi-associated protein, GOLT1 may regulate vesicle formation or cargo sorting between the ER and Golgi.

  • Post-Translational Modifications: Its localization to internal membranes (e.g., ER/Golgi) suggests roles in protein maturation or quality control.

Limitations: No experimental data (e.g., knockout phenotypes, interactome studies) are publicly available to validate these hypotheses.

Research Applications

Recombinant GOLT1 is marketed as a tool for:

  1. Subcellular Localization Studies: Using tagged versions (e.g., GFP-fusions) to map protein trafficking pathways.

  2. Biochemical Assays: Investigating interactions with cargo proteins or transport machinery components.

  3. Structural Analysis: Enabling cryo-EM or X-ray crystallography studies to resolve its 3D structure .

ApplicationMethodPotential Insights
ImmunofluorescenceFluorescently labeled GOLT1 antibodiesLocalization to ER/Golgi membranes
Co-IP/Pull-DownHis-tag affinity chromatographyIdentification of binding partners
Functional KnockoutCRISPR-Cas9 editing in D. discoideumPhenotypic analysis of transport defects

Comparative Context: GOT1 in Other Organisms

OrganismGOT1/GOLT1 FunctionKey Findings
MammalsSerine biosynthesis, redox balance, HIF1α regulationCritical for CD8+ T cell proliferation under serine deprivation
D. discoideumHypothetical: Golgi transportNo published functional studies

Gaps and Future Directions

  • Functional Studies: No data exist on GOLT1’s role in D. discoideum development (e.g., aggregation, fruiting body formation).

  • Interactome Mapping: Identification of binding partners (e.g., SNARE proteins, cargo receptors) is needed.

  • Structural Biology: Solving GOLT1’s structure could reveal conserved domains with mammalian GOT1 or novel motifs.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. If you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid protein is 6 months at -20°C/-80°C. The shelf life of lyophilized protein is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing it for your order.
Synonyms
golt1; DDB_G0292868; Protein transport protein got1 homolog; Golgi transport protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-138
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
golt1
Target Protein Sequence
MFTDQQKIGAMLSAMGLFFGFLGVLLFLDRNLLALGNLLLVSGIVLILGLQKTTKFFAQK KKIKGTILFFFGIVVLLVTRWTFVGMVIEIFGFVNLFGDAFPIVISILRKLPIIGNILNH PLVNRLLQKADSGNELPF
Uniprot No.

Target Background

Function
May be involved in the fusion of ER-derived transport vesicles with the Golgi complex.
Database Links
Protein Families
GOT1 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

How does D. discoideum serve as a model organism for studying protein transport systems?

Dictyostelium discoideum serves as an excellent model organism for studying protein transport due to its unique developmental cycle and genetic tractability. When starved, D. discoideum amoebae initiate a developmental process that culminates in the formation of fruiting bodies containing spores supported by stalks . This developmental process requires precise protein transport and autophagy mechanisms to provide nutrients and energy.

Unlike many other model organisms, D. discoideum combines aspects of both unicellular and multicellular life stages, allowing researchers to study protein transport in both contexts. The organism's genome is fully sequenced, and many transport proteins show significant homology to mammalian counterparts, making it valuable for comparative studies of evolutionary conservation in protein transport systems .

What experimental methods are recommended for visualizing Golt1 localization in D. discoideum cells?

For visualizing Golt1 localization in D. discoideum cells, fluorescent protein tagging is highly recommended. Based on methods used for similar proteins:

  • GFP/RFP Tagging Approach:

    • Create a fusion construct of Golt1 with GFP or RFP at either N- or C-terminus

    • Express the fusion protein using an appropriate D. discoideum expression vector

    • Visualize using confocal microscopy to determine subcellular localization

  • Co-localization Studies:

    • Co-express Golt1-GFP with established Golgi markers (e.g., Golgi-RFP)

    • Analyze overlap of fluorescent signals to confirm Golgi localization

    • Quantify co-localization using Pearson's correlation coefficient

  • Live Cell Imaging:

    • Use time-lapse confocal microscopy to track Golt1-GFP movement

    • Apply temporal resolution of 5-10 seconds between frames

    • Track vesicular movement using particle tracking software

This approach has been successfully implemented with other D. discoideum proteins such as Atg1, where researchers used GFP-tagged kinase-negative Atg1 to study its colocalization with RFP-tagged Atg8 .

What are the optimal conditions for expressing recombinant D. discoideum Golt1 in E. coli systems?

For optimal expression of recombinant D. discoideum Golt1 in E. coli, the following methodological approach is recommended:

Expression System Optimization:

ParameterRecommended ConditionRationale
E. coli strainBL21(DE3) or Rosetta(DE3)Enhanced expression of eukaryotic membrane proteins
Expression vectorpET with N-terminal His-tagFacilitates purification while preserving function
Induction temperature18-20°CReduces inclusion body formation
IPTG concentration0.1-0.5 mMModerate induction promotes proper folding
Post-induction time16-20 hoursExtended time at lower temperature improves yield
MediaTB or 2XYT supplemented with 1% glucoseRich media supports membrane protein expression

Since Golt1 is a membrane-associated protein, expression conditions must be carefully optimized to prevent aggregation and facilitate proper folding. The commercially available recombinant protein is expressed with an N-terminal His-tag in E. coli, suggesting this approach is viable .

What purification strategy yields the highest purity and activity for recombinant Golt1?

A multi-step purification approach is essential for obtaining high-purity, active recombinant Golt1:

  • Cell Lysis and Membrane Extraction:

    • Resuspend cell pellet in lysis buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 1 mM PMSF)

    • Disrupt cells via sonication or high-pressure homogenization

    • Isolate membrane fraction by ultracentrifugation (100,000 × g, 1 hour)

  • Detergent Solubilization:

    • Solubilize membrane proteins using mild detergents (0.5-1% n-dodecyl-β-D-maltoside or CHAPS)

    • Incubate for 1-2 hours at 4°C with gentle agitation

    • Remove insoluble material by centrifugation (20,000 × g, 30 minutes)

  • Affinity Chromatography:

    • Apply solubilized fraction to Ni-NTA column

    • Wash extensively with buffer containing 20-40 mM imidazole

    • Elute with stepwise or gradient imidazole (50-300 mM)

  • Size Exclusion Chromatography:

    • Further purify using gel filtration column (Superose 6 or Superdex 200)

    • Collect monomeric fraction to ensure homogeneity

  • Quality Control:

    • Verify purity by SDS-PAGE (>90% homogeneity)

    • Confirm identity by Western blot or mass spectrometry

For storage, lyophilization in Tris/PBS-based buffer with 6% trehalose at pH 8.0 has been shown to maintain protein stability .

How should researchers validate the structural integrity of purified recombinant Golt1?

Validation of structural integrity for purified recombinant Golt1 should follow a comprehensive approach:

  • Biophysical Characterization:

    • Circular Dichroism (CD) spectroscopy to assess secondary structure

    • Thermal shift assays to evaluate stability

    • Dynamic Light Scattering (DLS) to confirm monodispersity

  • Functional Validation:

    • Liposome binding assays to verify membrane association capability

    • In vitro vesicle transport assays if applicable

    • Protein-protein interaction studies with known Golgi transport partners

  • Structural Analysis:

    • Limited proteolysis to assess folding and domain organization

    • Analytical ultracentrifugation to determine oligomeric state

    • If possible, structural determination via X-ray crystallography or cryo-EM

  • Reconstitution Experiments:

    • After lyophilization, reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to 5-50% final concentration for long-term storage

    • Verify activity after reconstitution to ensure functionality is preserved

How can researchers effectively design knockdown or knockout studies for Golt1 in D. discoideum?

Effective genetic manipulation of Golt1 in D. discoideum requires careful experimental design:

Knockdown Approach:

  • RNA Interference (RNAi):

    • Design hairpin constructs targeting unique regions of golt1 mRNA

    • Clone into an inducible expression vector (e.g., doxycycline-inducible system)

    • Transform D. discoideum cells and select stable transformants

    • Validate knockdown efficiency by qRT-PCR and Western blot

Knockout Approach:

  • CRISPR-Cas9 System:

    • Design sgRNAs targeting the golt1 coding sequence

    • Prepare a homology-directed repair template with selection marker

    • Transform cells with CRISPR-Cas9 and template constructs

    • Screen clones by PCR and sequencing to confirm gene disruption

Temperature-Sensitive Mutant:

  • Random or Site-Directed Mutagenesis:

    • Generate temperature-sensitive mutants through random or site-directed mutagenesis

    • Screen for clones that show normal function at permissive temperature but lose function at restrictive temperature

    • This approach allows for temporal control of protein function, as has been successfully done with DdAtg1

Phenotypic Analysis:

  • Monitor effects on growth, development, and protein trafficking

  • Assess Golgi morphology using fluorescent markers

  • Evaluate protein transport using cargo trafficking assays

This methodological framework is inspired by successful approaches used for studying other D. discoideum proteins like Atg1, where researchers used both knockout and temperature-sensitive mutants to study protein function throughout development .

What approaches are recommended for studying Golt1 interactions with other proteins in the Golgi transport system?

To study Golt1 interactions with other proteins in the Golgi transport system, researchers should employ multiple complementary approaches:

  • Co-Immunoprecipitation (Co-IP):

    • Express epitope-tagged Golt1 (e.g., His-tag, FLAG-tag) in D. discoideum

    • Lyse cells under mild conditions to preserve protein-protein interactions

    • Perform pull-down with appropriate antibodies against the tag

    • Identify interacting partners by mass spectrometry

  • Proximity Labeling Methods:

    • Generate fusion constructs of Golt1 with BioID or APEX2

    • Express in D. discoideum cells and activate labeling

    • Identify proximal proteins by streptavidin pull-down and mass spectrometry

    • This approach identifies proteins in close proximity in vivo

  • Yeast Two-Hybrid (Y2H) Screening:

    • Use Golt1 as bait to screen D. discoideum cDNA library

    • Validate positive interactions with targeted Y2H assays

    • Confirm in vivo with co-localization studies

  • Fluorescence Resonance Energy Transfer (FRET):

    • Generate fluorescent protein fusions (e.g., CFP-Golt1 and YFP-potential interactor)

    • Measure FRET in live cells to detect direct protein-protein interactions

    • Quantify interaction strength through FRET efficiency calculations

  • Analytical Techniques:

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS)

    • Surface plasmon resonance (SPR) for quantitative binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

These approaches can reveal both stable and transient interactions within the Golgi transport system, providing insights into the functional network of Golt1.

How can metabolic labeling be used to track Golt1-mediated protein transport in D. discoideum?

Metabolic labeling provides a powerful approach to track Golt1-mediated protein transport in D. discoideum:

Pulse-Chase Analysis:

  • Experimental Setup:

    • Starve D. discoideum cells for 30 minutes in amino acid-free medium

    • Pulse with [35S]-methionine or [35S]-cysteine for 10-15 minutes

    • Chase with excess unlabeled amino acids for varying time periods (0-120 minutes)

  • Subcellular Fractionation:

    • Collect cells at different chase time points

    • Perform gentle lysis and separate cellular compartments by differential centrifugation

    • Isolate Golgi fractions using sucrose gradient ultracentrifugation

  • Immunoprecipitation of Cargo Proteins:

    • Immunoprecipitate known secretory cargo proteins from each fraction

    • Analyze by SDS-PAGE and autoradiography

    • Quantify the time-dependent appearance of labeled cargo in different compartments

  • Comparative Analysis:

    • Compare transport kinetics between wild-type and Golt1-depleted cells

    • Calculate half-times for cargo transit through different compartments

    • Identify transport steps dependent on Golt1 function

This methodological approach can be complemented with microscopy-based techniques, such as visualizing the transport of fluorescently tagged cargo proteins in real-time, to provide a comprehensive understanding of Golt1's role in protein transport.

What is the relationship between Golt1 and autophagy pathways in D. discoideum during development?

While the search results don't directly address Golt1's relationship with autophagy in D. discoideum, we can formulate a research framework based on related studies:

Autophagy in D. discoideum Development:
D. discoideum relies heavily on autophagy during development, particularly during starvation-induced fruiting body formation. Autophagy provides the nutrients and energy necessary for this developmental process .

Potential Golt1-Autophagy Connections:

  • Vesicular Transport Intersection:

    • Golt1, as a Golgi transport protein, may regulate membrane trafficking events that contribute to autophagosome formation

    • The Golgi apparatus can serve as a membrane source for autophagosomes

  • Developmental Regulation:

    • Both Golt1-mediated transport and autophagy are likely upregulated during starvation

    • Temporal coordination between these pathways would be essential for proper development

  • Experimental Approach to Study This Relationship:

    • Generate D. discoideum strains with fluorescently tagged Golt1 and autophagy markers (e.g., Atg8)

    • Perform co-localization studies during different developmental stages

    • Create Golt1 knockout or knockdown strains and assess impacts on autophagy through standard assays (e.g., GFP-Atg8 puncta formation)

    • Examine whether Golt1 associates with known autophagy proteins through co-immunoprecipitation

  • Comparative Analysis with Atg1 Studies:

    • Research on Atg1 in D. discoideum has shown that autophagy is essential throughout development

    • Temperature-sensitive mutants of Atg1 demonstrate that development halts when autophagy is disrupted but resumes when function is restored

    • Similar approaches could determine if Golt1 has comparable developmental requirements

Exploring these connections would provide valuable insights into the coordination of membrane trafficking pathways during D. discoideum development.

How might post-translational modifications regulate Golt1 function in different cellular contexts?

Post-translational modifications (PTMs) likely play critical roles in regulating Golt1 function, though specific data for D. discoideum Golt1 is not provided in the search results. Based on knowledge of similar proteins, the following framework can guide research on Golt1 PTMs:

Predicted PTM Sites and Their Functions:

  • Phosphorylation:

    • Potential phosphorylation sites should be identified using prediction tools (e.g., NetPhos)

    • Phosphorylation may regulate protein-protein interactions or subcellular localization

    • Key kinases in D. discoideum (e.g., PKA, ERK family) might target Golt1 during developmental transitions

  • Palmitoylation:

    • As a membrane protein, Golt1 may undergo palmitoylation on cysteine residues

    • This modification could regulate membrane association and protein stability

    • Palmitoylation/depalmitoylation cycles might control dynamic relocation during cellular stress

  • Ubiquitination:

    • Lysine residues may be targets for ubiquitination

    • This modification could regulate protein turnover and quality control

    • Changes in ubiquitination patterns during development may control Golt1 levels

Methodological Approaches to Study PTMs:

  • Mass Spectrometry-Based Analysis:

    • Immunoprecipitate Golt1 from D. discoideum cells at different developmental stages

    • Perform LC-MS/MS analysis to identify and quantify PTMs

    • Compare PTM profiles between growth and development phases

  • Site-Directed Mutagenesis:

    • Generate mutants where predicted PTM sites are replaced with non-modifiable residues

    • Express these mutants in Golt1-knockout backgrounds

    • Assess functional consequences through localization and transport assays

  • PTM-Specific Antibodies:

    • Develop antibodies against specific predicted PTMs of Golt1

    • Use these to track modification status during development

    • Perform immunofluorescence to correlate PTMs with subcellular localization

This research direction would provide significant insights into the regulatory mechanisms controlling Golt1 function during D. discoideum growth and development.

What are the common challenges in expressing and purifying functional recombinant Golt1, and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant Golt1. Here are methodological solutions to address these issues:

Challenge 1: Low Expression Levels

  • Solution: Optimize codon usage for E. coli expression by synthesizing a codon-optimized gene

  • Solution: Test multiple E. coli strains (BL21, C41/C43, Rosetta) specifically designed for membrane protein expression

  • Solution: Explore fusion tags that enhance solubility (e.g., MBP, SUMO) in addition to the His-tag

Challenge 2: Protein Aggregation/Inclusion Bodies

  • Solution: Reduce induction temperature to 16-18°C and extend expression time to 18-24 hours

  • Solution: Decrease IPTG concentration to 0.1 mM for gentler induction

  • Solution: Add chemical chaperones (e.g., 5% glycerol, 1M sorbitol) to the culture medium

  • Solution: If inclusion bodies persist, develop refolding protocols using gradual dialysis

Challenge 3: Poor Solubilization

  • Solution: Screen multiple detergents (DDM, CHAPS, LDAO) at various concentrations

  • Solution: Test detergent mixtures that may better mimic native membrane environment

  • Solution: Incorporate lipids during solubilization to stabilize the protein

Challenge 4: Protein Instability

  • Solution: Include protease inhibitors throughout purification

  • Solution: Maintain strict temperature control (4°C) during all purification steps

  • Solution: Add stabilizing agents such as trehalose (6%) as used in commercial preparations

  • Solution: Consider adding specific lipids that may stabilize the protein

Challenge 5: Loss of Function After Purification

  • Solution: Validate protein folding using circular dichroism

  • Solution: Reconstitute into liposomes or nanodiscs to restore native-like membrane environment

  • Solution: Store in smaller aliquots at -80°C to avoid freeze-thaw cycles

For long-term storage, lyophilization in Tris/PBS-based buffer with 6% trehalose at pH 8.0 has proven effective , but researchers should verify that the reconstituted protein retains functionality through appropriate activity assays.

How can researchers optimize experimental conditions for studying Golt1 function in vitro?

Optimizing experimental conditions for studying Golt1 function in vitro requires systematic approach to multiple parameters:

Buffer Optimization:

ComponentRange to TestPurpose
pH6.5-8.0Identify optimal pH for stability and activity
Salt (NaCl)100-500 mMDetermine ionic strength requirements
Glycerol0-20%Stabilize protein structure
Reducing agents0-5 mM DTT/BMEMaintain cysteine residues
Detergents1-5× CMCMaintain membrane protein solubility

Temperature Stability Analysis:

  • Perform thermal shift assays to determine optimal temperature range

  • Assess activity after incubation at different temperatures (4°C, 25°C, 37°C)

  • Determine if temperature sensitivity can be used as an experimental tool, as done with other D. discoideum proteins

Reconstitution Systems:

  • Liposome Reconstitution:

    • Prepare liposomes with defined lipid composition

    • Incorporate purified Golt1 using detergent removal methods

    • Verify proper orientation using protease protection assays

  • Cell-Free Expression Systems:

    • Express Golt1 directly into artificial membranes or nanodiscs

    • Avoid potentially harmful effects of detergent solubilization

  • Vesicle Trafficking Assays:

    • Develop in vitro assays mimicking Golgi transport steps

    • Measure Golt1-dependent vesicle fusion or cargo transfer

    • Use fluorescence-based readouts for quantitative analysis

By systematically optimizing these conditions, researchers can develop robust in vitro systems for studying Golt1 function that more accurately reflect the protein's native activity.

What approaches can address contradictory data when studying Golt1 interactions and functions?

When researchers encounter contradictory data regarding Golt1 interactions and functions, a systematic troubleshooting approach is essential:

Methodological Reconciliation Strategy:

  • Validate Protein Identity and Quality:

    • Confirm protein sequence by mass spectrometry

    • Assess protein homogeneity by size exclusion chromatography

    • Check for post-translational modifications that might affect function

    • Verify activity using established functional assays

  • Compare Experimental Conditions:

    • Create a detailed table comparing all experimental variables between contradictory studies

    • Systematically test whether differences in buffer composition, pH, temperature, or protein concentration explain discrepancies

    • Consider effects of tags and fusion partners on protein behavior

  • Cross-Validate Using Multiple Techniques:

    • If protein-protein interactions show discrepancies, confirm using orthogonal methods:

      • If Y2H gives positive result but Co-IP is negative, try proximity labeling

      • If in vitro binding differs from in vivo results, examine cellular context factors

    • For functional studies, employ both gain-of-function and loss-of-function approaches

  • Consider Biological Context:

    • Test whether developmental stage affects results

    • Examine whether nutrient conditions alter Golt1 function

    • Assess whether Golt1 has different functions in different cellular compartments

  • Advanced Resolution Approaches:

    • Perform domain mapping to identify regions responsible for specific interactions

    • Generate point mutants to disrupt specific functions while preserving others

    • Use temperature-sensitive mutations to control protein function temporally, similar to approaches used with D. discoideum Atg1

  • Collaborative Verification:

    • Exchange reagents between laboratories reporting conflicting results

    • Perform key experiments in both laboratories using standardized protocols

    • Consider blind testing of samples to eliminate unconscious bias

This methodological framework not only resolves contradictions but often leads to deeper insights into the complex and context-dependent functions of proteins like Golt1.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.