The Recombinant Dictyostelium discoideum Protein YIPF5 homolog (yipf5) is a full-length, engineered version of the endogenous yipf5 gene product from Dictyostelium discoideum. This protein belongs to the YIP1 family, which is implicated in membrane trafficking, particularly in endoplasmic reticulum (ER)-Golgi transport . The recombinant form is produced via bacterial expression systems (e.g., E. coli) and is His-tagged for purification and downstream applications .
| Property | Details |
|---|---|
| Gene Symbol | yipf5 |
| Protein Length | 212 amino acids (full-length) |
| Tag | N-terminal 10xHis-tag |
| Expression System | E. coli |
| Uniprot ID | Q54QY3 (Dictyostelium) |
| Commercial Availability | Creative BioMart (RFL30131DF), Cusabio (CSB-CF709803DKK), MyBioSource |
The recombinant YIPF5 homolog retains the native protein’s topology, including transmembrane domains and motifs critical for membrane association. Key features include:
Sequence: MNNNNSFNFIDSQYSTPQGAYYDNTGRMGGGGGMGGPTDSFDNELPLLEELGINFDHIRSKTLSVLNPLKKIDSHIMDDTDLGGPILFGLLLGFSLLMSGKIQFGYIYGLGLIGCVSMYIVLNLMSEKGIDIYRVISVLGYCLLPMIFLSFTSLIININGMVGYILIGFAIVWSTYSA SKMFVKVLSMIDQRILVAYPVGLLYTGFALITAF .
YIPF5 is integral to membrane trafficking pathways, particularly ER-to-Golgi transport. It interacts with:
These interactions position YIPF5 as a critical regulator in maintaining organelle dynamics and protein secretion .
The YIPF5 antibody (12931-1-AP) from Proteintech enables:
Western Blot (WB): Detects bands at 28–33 kDa in mouse/rat brain and liver tissues .
Immunohistochemistry (IHC): Stains human intrahepatic cholangiocarcinoma and ovarian cancer tissues (antigen retrieval required) .
Recombinant YIPF5 is used to investigate:
Vesicle trafficking: Knockout models in Dictyostelium reveal defects in ER-Golgi dynamics .
Pathogen interactions: Proteins like YIPF5 may influence Legionella pneumophila vacuole formation, though direct evidence for YIPF5 is limited .
Mechanistic Studies: Elucidating YIPF5’s role in retrograde trafficking (e.g., via coatomer interactions) .
Therapeutic Targets: Exploring its relevance in diseases involving trafficking defects (e.g., neurodegenerative disorders) .
Cross-Species Functional Analogy: Leveraging homology with human YIPF5 (Q969M3) to model ER-Golgi dynamics in eukaryotes .
KEGG: ddi:DDB_G0283541
STRING: 44689.DDB0238115
The YIPF5 homolog in Dictyostelium discoideum is also referred to as yipf1 (gene name) or Protein YIPF1 homolog, with the UniProt ID Q54TS4 and gene identifier DDB_G0281587. It is a multi-spanning membrane protein comprising 347 amino acids that is structurally and functionally related to the human YIPF5 protein . The Dictyostelium discoideum YIPF5 homolog likely plays a role in membrane trafficking between the endoplasmic reticulum (ER) and Golgi apparatus, similar to its mammalian counterparts .
For optimal reconstitution of lyophilized recombinant Dictyostelium discoideum YIPF5 homolog:
Briefly centrifuge the vial prior to opening to bring contents to the bottom
Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL
Add glycerol to a final concentration of 5-50% (50% is recommended as standard)
Aliquot for long-term storage at -20°C/-80°C to avoid repeated freeze-thaw cycles
Working aliquots can be stored at 4°C for up to one week
The protein is delivered in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, which helps maintain stability during the lyophilization process .
To determine the membrane topology of Dictyostelium discoideum YIPF5 homolog, researchers can employ several complementary techniques:
Protease protection assays: Using selective proteolytic digestion of intact vesicles or permeabilized membranes to identify cytosolic versus luminal domains
Fluorescence-based approaches: Creating fusion constructs with GFP or similar tags at different termini or within predicted loops
Epitope insertion and accessibility studies: Introducing epitope tags at various positions followed by immunofluorescence with or without membrane permeabilization
Glycosylation mapping: Adding N-glycosylation sites at different positions to identify luminal domains
Cysteine accessibility methods: Introducing cysteine residues at various positions and testing their accessibility to membrane-impermeable sulfhydryl reagents
These approaches, similar to those used for characterizing other multi-spanning membrane proteins like NSF in Dictyostelium discoideum, can provide insights into how YIPF5 is oriented in cellular membranes .
The Dictyostelium discoideum YIPF5 homolog likely shares functional similarities with human YIPF5, though with some evolutionary distinctions:
| Feature | Human YIPF5 | D. discoideum YIPF5 homolog |
|---|---|---|
| Cellular localization | ER, ERGIC, Golgi apparatus | Predicted similar localization |
| Primary function | ER-Golgi trafficking | Likely involved in membrane trafficking |
| Disease association | Mutations cause neonatal diabetes and microcephaly | Not established |
| Role in stress response | Deficiency leads to ER stress in β-cells | Unknown, potential research area |
| Protein interactions | Forms complexes with COPII components | Predicted to interact with vesicular transport machinery |
Research suggests human YIPF5 is critical for proinsulin processing and ER-to-Golgi trafficking, with deficiency resulting in proinsulin retention in the ER, marked ER stress, and β-cell failure . The Dictyostelium homolog likely functions in comparable membrane trafficking pathways, making it a valuable model for studying fundamental aspects of this protein family .
CRISPR-Cas9 gene editing offers powerful approaches to investigate YIPF5 function in Dictyostelium discoideum:
Knockout studies:
Design sgRNAs targeting conserved regions of the yipf1 gene
Verify knockout efficiency through sequencing and Western blotting
Analyze phenotypic changes in membrane organization, secretory pathway function, and developmental processes
Domain-specific mutations:
Introduce precise mutations mimicking human disease variants (e.g., equivalents to p.Ala181Val or p.Lys106del)
Create domain-specific mutations to determine functional regions
Fluorescent tagging for live imaging:
Insert fluorescent protein tags for real-time visualization of YIPF5 trafficking
Study dynamics during cell development and response to stress conditions
Complementation studies:
Express human YIPF5 in Dictyostelium knockout lines to assess functional conservation
Determine if human disease variants can rescue phenotypes
This approach would parallel methodologies used in studying other vesicular transport proteins in Dictyostelium, such as NSF, which has been characterized using similar molecular techniques .
To investigate YIPF5's role in ER stress responses in Dictyostelium discoideum, researchers can employ these methodologies:
ER stress induction protocols:
Chemical inducers: Tunicamycin (N-glycosylation inhibitor), thapsigargin (SERCA inhibitor), DTT (reducing agent)
Monitor cellular responses in wild-type versus YIPF5-deficient cells
Stress marker analysis:
RT-qPCR of Dictyostelium ER stress response genes
Western blotting for phosphorylated stress sensors
Immunofluorescence to visualize ER morphology changes
Functional assays:
Protein secretion efficiency measurements during stress
Live-cell imaging of ER-to-Golgi transport under stress conditions
Apoptosis/cell death quantification following prolonged stress
Transcriptomic and proteomic approaches:
RNA-seq to identify differentially expressed genes in YIPF5-deficient cells under stress
Proteomic analysis of the secretome and ER-retained proteins
Human studies have demonstrated that YIPF5 deficiency sensitizes β-cells to ER stress-induced apoptosis, suggesting the Dictyostelium homolog may have similar protective functions against cellular stress .
To dissect YIPF5's precise role in bidirectional trafficking:
Cargo-specific trafficking assays:
Track fluorescently-tagged model proteins known to undergo exclusively anterograde (e.g., secretory proteins) or retrograde (e.g., ER-resident proteins with KDEL retrieval signals) transport
Measure transport kinetics and steady-state distributions
Vesicle formation analysis:
Electron microscopy to visualize COPII versus COPI vesicle formation at ER exit sites and Golgi
Immunogold labeling to determine YIPF5 association with specific vesicle populations
Protein interaction studies:
Co-immunoprecipitation with known components of anterograde (COPII) versus retrograde (COPI) machinery
Proximity labeling techniques (BioID, APEX) to identify the YIPF5 interactome
Small molecule inhibitors:
Selective disruption of anterograde versus retrograde pathways and assessment of YIPF5 localization and function
This methodological approach addresses the current debate regarding YIPF5's function, as there is evidence supporting both anterograde roles (ER membrane organization and cargo exit) and retrograde roles (Golgi-to-ER transport) .
Investigating YIPF5 expression patterns during Dictyostelium development requires:
Temporal expression analysis:
RT-qPCR and Western blotting at different developmental stages (vegetative growth, aggregation, mound formation, slug migration, culmination)
RNA-seq data analysis across developmental timepoints
Spatial expression studies:
In situ hybridization to visualize mRNA localization during development
Immunofluorescence or live imaging with tagged constructs to track protein distribution
Cell-type specific analysis in developing multicellular structures
Promoter analysis:
Reporter gene constructs to identify regulatory elements
ChIP-seq to identify transcription factors binding to the YIPF5 promoter
Environmental regulation assessment:
Expression analysis under different nutrient conditions, stress stimuli, and cell densities
Since studies of other proteins in Dictyostelium, such as NSF, have shown constant expression during vegetative growth and throughout the differentiation cycle, it would be valuable to determine if YIPF5 follows similar or distinct expression patterns .
Comparative analysis across species can yield insights into evolutionary conservation and functional importance:
| Species | YIPF5 Homolog Features | Sequence Identity to Human | Known Functions |
|---|---|---|---|
| Human | 257 aa, membrane protein | 100% | ER-Golgi trafficking, essential for β-cell function |
| D. discoideum | 347 aa, membrane protein | Approximately 30-40%* | Predicted membrane trafficking roles |
| Rat | Similar to human | High (>90%)* | Similar to human |
| Zebrafish | Present | Moderate (60-70%)* | Developmental roles |
| Chicken | Present | Moderate (60-70%)* | Not well characterized |
| Pongo abelii (orangutan) | Similar to human | Very high (>95%)* | Predicted similar to human |
*Estimated values based on typical conservation patterns; exact percentages would require direct sequence alignment analysis
Comparative analyses should focus on:
Conservation of transmembrane domains and functional motifs
Lineage-specific adaptations in protein length and domain organization
Co-evolution with interacting proteins in the secretory pathway
Correlation between YIPF5 conservation and complexity of the endomembrane system
The human YIPF5 mutations associated with neonatal diabetes and microcephaly (p.Ala181Val and p.Lys106del) could serve as reference points to identify evolutionarily conserved critical residues across species .
Researchers frequently encounter these challenges when working with recombinant YIPF5:
Protein solubility issues:
YIPF5 is a multi-spanning membrane protein, making it inherently difficult to solubilize
Solution: Optimize detergent type and concentration; consider fusion tags that enhance solubility
Protein aggregation:
Membrane proteins often aggregate during expression and purification
Solution: Reduce expression temperature; use stabilizing additives; optimize buffer conditions
Low expression yield:
Complex membrane proteins may express poorly in bacterial systems
Solution: Explore alternative expression systems (insect cells, mammalian cells); optimize codon usage
Protein functionality:
Recombinant protein may lack post-translational modifications or proper folding
Solution: Validate functionality through binding assays and structural analyses
Storage stability:
To ensure purified recombinant YIPF5 retains its native functional properties:
Structural integrity assessment:
Circular dichroism (CD) spectroscopy to confirm secondary structure content
Limited proteolysis to verify proper folding
Size exclusion chromatography to confirm monodispersity
Binding partner interactions:
Pull-down assays with known or predicted interaction partners
Surface plasmon resonance (SPR) to measure binding kinetics
Microscale thermophoresis for quantitative interaction analysis
Reconstitution into model membranes:
Liposome incorporation followed by functional assays
Proteoliposome formation to mimic native membrane environment
Planar lipid bilayer experiments for detailed functional studies
Comparative analysis:
Parallel testing with native protein immunoprecipitated from Dictyostelium
Comparison of biochemical properties with orthologs from other species
Complementation studies:
Ability to rescue phenotypes in YIPF5-deficient cellular models
Proper validation ensures experimental results accurately reflect the protein's native biological functions rather than artifacts of the recombinant expression system .