Recombinant Dictyostelium discoideum Protein YIPF5 homolog (yipf5)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant YIPF5 Homolog

The Recombinant Dictyostelium discoideum Protein YIPF5 homolog (yipf5) is a full-length, engineered version of the endogenous yipf5 gene product from Dictyostelium discoideum. This protein belongs to the YIP1 family, which is implicated in membrane trafficking, particularly in endoplasmic reticulum (ER)-Golgi transport . The recombinant form is produced via bacterial expression systems (e.g., E. coli) and is His-tagged for purification and downstream applications .

PropertyDetails
Gene Symbolyipf5
Protein Length212 amino acids (full-length)
TagN-terminal 10xHis-tag
Expression SystemE. coli
Uniprot IDQ54QY3 (Dictyostelium)
Commercial AvailabilityCreative BioMart (RFL30131DF), Cusabio (CSB-CF709803DKK), MyBioSource

Primary Structure

The recombinant YIPF5 homolog retains the native protein’s topology, including transmembrane domains and motifs critical for membrane association. Key features include:

  • Sequence: MNNNNSFNFIDSQYSTPQGAYYDNTGRMGGGGGMGGPTDSFDNELPLLEELGINFDHIRSKTLSVLNPLKKIDSHIMDDTDLGGPILFGLLLGFSLLMSGKIQFGYIYGLGLIGCVSMYIVLNLMSEKGIDIYRVISVLGYCLLPMIFLSFTSLIININGMVGYILIGFAIVWSTYSA SKMFVKVLSMIDQRILVAYPVGLLYTGFALITAF .

  • Molecular Weight: ~28–33 kDa (observed in SDS-PAGE) .

Functional Role

YIPF5 is integral to membrane trafficking pathways, particularly ER-to-Golgi transport. It interacts with:

Interaction PartnerFunctionScore (STRING DB)
YIPF6YIP1 family member; roles in vesicle transport0.940
Coatomer subunitsMediates retrograde Golgi-to-ER transport0.705
SEC23/SEC24COPII complex components; ER vesicle formation and cargo selection0.454–0.450

These interactions position YIPF5 as a critical regulator in maintaining organelle dynamics and protein secretion .

Antibody-Based Detection

The YIPF5 antibody (12931-1-AP) from Proteintech enables:

  • Western Blot (WB): Detects bands at 28–33 kDa in mouse/rat brain and liver tissues .

  • Immunohistochemistry (IHC): Stains human intrahepatic cholangiocarcinoma and ovarian cancer tissues (antigen retrieval required) .

ApplicationDilutionReactivity
WB1:500–1:3000Human, mouse, rat
IHC1:50–1:500Human, mouse, rat

Functional Studies

Recombinant YIPF5 is used to investigate:

  • Vesicle trafficking: Knockout models in Dictyostelium reveal defects in ER-Golgi dynamics .

  • Pathogen interactions: Proteins like YIPF5 may influence Legionella pneumophila vacuole formation, though direct evidence for YIPF5 is limited .

Future Directions

  1. Mechanistic Studies: Elucidating YIPF5’s role in retrograde trafficking (e.g., via coatomer interactions) .

  2. Therapeutic Targets: Exploring its relevance in diseases involving trafficking defects (e.g., neurodegenerative disorders) .

  3. Cross-Species Functional Analogy: Leveraging homology with human YIPF5 (Q969M3) to model ER-Golgi dynamics in eukaryotes .

References

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. Should you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50% and can be used as a reference point.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms, on the other hand, have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development accordingly.
Synonyms
yipf5; DDB_G0283541; Protein YIPF5 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-212
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
yipf5
Target Protein Sequence
MNNNNSFNFIDSQYSTPQGAYYDNTGRMGGGGGMGGPTDSFDNELPLLEELGINFDHIRS KTLSVLNPLKKIDSHIMDDTDLGGPILFGLLLGFSLLMSGKIQFGYIYGLGLIGCVSMYI VLNLMSEKGIDIYRVISVLGYCLLPMIFLSFTSLIININGMVGYILIGFAIVWSTYSASK MFVKVLSMIDQRILVAYPVGLLYTGFALITAF
Uniprot No.

Target Background

Function
Plays a crucial role in the transport of proteins between the endoplasmic reticulum and the Golgi apparatus.
Database Links
Protein Families
YIP1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein.

Q&A

What is the YIPF5 homolog in Dictyostelium discoideum?

The YIPF5 homolog in Dictyostelium discoideum is also referred to as yipf1 (gene name) or Protein YIPF1 homolog, with the UniProt ID Q54TS4 and gene identifier DDB_G0281587. It is a multi-spanning membrane protein comprising 347 amino acids that is structurally and functionally related to the human YIPF5 protein . The Dictyostelium discoideum YIPF5 homolog likely plays a role in membrane trafficking between the endoplasmic reticulum (ER) and Golgi apparatus, similar to its mammalian counterparts .

How should recombinant Dictyostelium discoideum YIPF5 homolog be reconstituted for experimental use?

For optimal reconstitution of lyophilized recombinant Dictyostelium discoideum YIPF5 homolog:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended as standard)

  • Aliquot for long-term storage at -20°C/-80°C to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

The protein is delivered in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, which helps maintain stability during the lyophilization process .

What experimental approaches can be used to study the membrane topology of the YIPF5 homolog?

To determine the membrane topology of Dictyostelium discoideum YIPF5 homolog, researchers can employ several complementary techniques:

  • Protease protection assays: Using selective proteolytic digestion of intact vesicles or permeabilized membranes to identify cytosolic versus luminal domains

  • Fluorescence-based approaches: Creating fusion constructs with GFP or similar tags at different termini or within predicted loops

  • Epitope insertion and accessibility studies: Introducing epitope tags at various positions followed by immunofluorescence with or without membrane permeabilization

  • Glycosylation mapping: Adding N-glycosylation sites at different positions to identify luminal domains

  • Cysteine accessibility methods: Introducing cysteine residues at various positions and testing their accessibility to membrane-impermeable sulfhydryl reagents

These approaches, similar to those used for characterizing other multi-spanning membrane proteins like NSF in Dictyostelium discoideum, can provide insights into how YIPF5 is oriented in cellular membranes .

How does the function of Dictyostelium discoideum YIPF5 homolog compare to human YIPF5?

The Dictyostelium discoideum YIPF5 homolog likely shares functional similarities with human YIPF5, though with some evolutionary distinctions:

FeatureHuman YIPF5D. discoideum YIPF5 homolog
Cellular localizationER, ERGIC, Golgi apparatusPredicted similar localization
Primary functionER-Golgi traffickingLikely involved in membrane trafficking
Disease associationMutations cause neonatal diabetes and microcephalyNot established
Role in stress responseDeficiency leads to ER stress in β-cellsUnknown, potential research area
Protein interactionsForms complexes with COPII componentsPredicted to interact with vesicular transport machinery

Research suggests human YIPF5 is critical for proinsulin processing and ER-to-Golgi trafficking, with deficiency resulting in proinsulin retention in the ER, marked ER stress, and β-cell failure . The Dictyostelium homolog likely functions in comparable membrane trafficking pathways, making it a valuable model for studying fundamental aspects of this protein family .

How can CRISPR-Cas9 technology be applied to study YIPF5 function in Dictyostelium discoideum?

CRISPR-Cas9 gene editing offers powerful approaches to investigate YIPF5 function in Dictyostelium discoideum:

  • Knockout studies:

    • Design sgRNAs targeting conserved regions of the yipf1 gene

    • Verify knockout efficiency through sequencing and Western blotting

    • Analyze phenotypic changes in membrane organization, secretory pathway function, and developmental processes

  • Domain-specific mutations:

    • Introduce precise mutations mimicking human disease variants (e.g., equivalents to p.Ala181Val or p.Lys106del)

    • Create domain-specific mutations to determine functional regions

  • Fluorescent tagging for live imaging:

    • Insert fluorescent protein tags for real-time visualization of YIPF5 trafficking

    • Study dynamics during cell development and response to stress conditions

  • Complementation studies:

    • Express human YIPF5 in Dictyostelium knockout lines to assess functional conservation

    • Determine if human disease variants can rescue phenotypes

This approach would parallel methodologies used in studying other vesicular transport proteins in Dictyostelium, such as NSF, which has been characterized using similar molecular techniques .

What methods are most effective for studying the role of YIPF5 in ER stress responses?

To investigate YIPF5's role in ER stress responses in Dictyostelium discoideum, researchers can employ these methodologies:

  • ER stress induction protocols:

    • Chemical inducers: Tunicamycin (N-glycosylation inhibitor), thapsigargin (SERCA inhibitor), DTT (reducing agent)

    • Monitor cellular responses in wild-type versus YIPF5-deficient cells

  • Stress marker analysis:

    • RT-qPCR of Dictyostelium ER stress response genes

    • Western blotting for phosphorylated stress sensors

    • Immunofluorescence to visualize ER morphology changes

  • Functional assays:

    • Protein secretion efficiency measurements during stress

    • Live-cell imaging of ER-to-Golgi transport under stress conditions

    • Apoptosis/cell death quantification following prolonged stress

  • Transcriptomic and proteomic approaches:

    • RNA-seq to identify differentially expressed genes in YIPF5-deficient cells under stress

    • Proteomic analysis of the secretome and ER-retained proteins

Human studies have demonstrated that YIPF5 deficiency sensitizes β-cells to ER stress-induced apoptosis, suggesting the Dictyostelium homolog may have similar protective functions against cellular stress .

How can researchers differentiate between YIPF5's roles in anterograde versus retrograde ER-Golgi transport?

To dissect YIPF5's precise role in bidirectional trafficking:

  • Cargo-specific trafficking assays:

    • Track fluorescently-tagged model proteins known to undergo exclusively anterograde (e.g., secretory proteins) or retrograde (e.g., ER-resident proteins with KDEL retrieval signals) transport

    • Measure transport kinetics and steady-state distributions

  • Vesicle formation analysis:

    • Electron microscopy to visualize COPII versus COPI vesicle formation at ER exit sites and Golgi

    • Immunogold labeling to determine YIPF5 association with specific vesicle populations

  • Protein interaction studies:

    • Co-immunoprecipitation with known components of anterograde (COPII) versus retrograde (COPI) machinery

    • Proximity labeling techniques (BioID, APEX) to identify the YIPF5 interactome

  • Small molecule inhibitors:

    • Selective disruption of anterograde versus retrograde pathways and assessment of YIPF5 localization and function

This methodological approach addresses the current debate regarding YIPF5's function, as there is evidence supporting both anterograde roles (ER membrane organization and cargo exit) and retrograde roles (Golgi-to-ER transport) .

How is YIPF5 expression regulated during Dictyostelium development?

Investigating YIPF5 expression patterns during Dictyostelium development requires:

  • Temporal expression analysis:

    • RT-qPCR and Western blotting at different developmental stages (vegetative growth, aggregation, mound formation, slug migration, culmination)

    • RNA-seq data analysis across developmental timepoints

  • Spatial expression studies:

    • In situ hybridization to visualize mRNA localization during development

    • Immunofluorescence or live imaging with tagged constructs to track protein distribution

    • Cell-type specific analysis in developing multicellular structures

  • Promoter analysis:

    • Reporter gene constructs to identify regulatory elements

    • ChIP-seq to identify transcription factors binding to the YIPF5 promoter

  • Environmental regulation assessment:

    • Expression analysis under different nutrient conditions, stress stimuli, and cell densities

Since studies of other proteins in Dictyostelium, such as NSF, have shown constant expression during vegetative growth and throughout the differentiation cycle, it would be valuable to determine if YIPF5 follows similar or distinct expression patterns .

What can comparative analysis of YIPF5 across species reveal about its evolutionary conservation?

Comparative analysis across species can yield insights into evolutionary conservation and functional importance:

SpeciesYIPF5 Homolog FeaturesSequence Identity to HumanKnown Functions
Human257 aa, membrane protein100%ER-Golgi trafficking, essential for β-cell function
D. discoideum347 aa, membrane proteinApproximately 30-40%*Predicted membrane trafficking roles
RatSimilar to humanHigh (>90%)*Similar to human
ZebrafishPresentModerate (60-70%)*Developmental roles
ChickenPresentModerate (60-70%)*Not well characterized
Pongo abelii (orangutan)Similar to humanVery high (>95%)*Predicted similar to human

*Estimated values based on typical conservation patterns; exact percentages would require direct sequence alignment analysis

Comparative analyses should focus on:

  • Conservation of transmembrane domains and functional motifs

  • Lineage-specific adaptations in protein length and domain organization

  • Co-evolution with interacting proteins in the secretory pathway

  • Correlation between YIPF5 conservation and complexity of the endomembrane system

The human YIPF5 mutations associated with neonatal diabetes and microcephaly (p.Ala181Val and p.Lys106del) could serve as reference points to identify evolutionarily conserved critical residues across species .

What are the common challenges in expressing and purifying recombinant Dictyostelium YIPF5 homolog?

Researchers frequently encounter these challenges when working with recombinant YIPF5:

  • Protein solubility issues:

    • YIPF5 is a multi-spanning membrane protein, making it inherently difficult to solubilize

    • Solution: Optimize detergent type and concentration; consider fusion tags that enhance solubility

  • Protein aggregation:

    • Membrane proteins often aggregate during expression and purification

    • Solution: Reduce expression temperature; use stabilizing additives; optimize buffer conditions

  • Low expression yield:

    • Complex membrane proteins may express poorly in bacterial systems

    • Solution: Explore alternative expression systems (insect cells, mammalian cells); optimize codon usage

  • Protein functionality:

    • Recombinant protein may lack post-translational modifications or proper folding

    • Solution: Validate functionality through binding assays and structural analyses

  • Storage stability:

    • Membrane proteins often lose activity during storage

    • Solution: Store with glycerol (5-50%); avoid repeated freeze-thaw cycles; keep working aliquots at 4°C for up to one week

How can researchers validate the functional integrity of purified recombinant YIPF5 homolog?

To ensure purified recombinant YIPF5 retains its native functional properties:

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure content

    • Limited proteolysis to verify proper folding

    • Size exclusion chromatography to confirm monodispersity

  • Binding partner interactions:

    • Pull-down assays with known or predicted interaction partners

    • Surface plasmon resonance (SPR) to measure binding kinetics

    • Microscale thermophoresis for quantitative interaction analysis

  • Reconstitution into model membranes:

    • Liposome incorporation followed by functional assays

    • Proteoliposome formation to mimic native membrane environment

    • Planar lipid bilayer experiments for detailed functional studies

  • Comparative analysis:

    • Parallel testing with native protein immunoprecipitated from Dictyostelium

    • Comparison of biochemical properties with orthologs from other species

  • Complementation studies:

    • Ability to rescue phenotypes in YIPF5-deficient cellular models

Proper validation ensures experimental results accurately reflect the protein's native biological functions rather than artifacts of the recombinant expression system .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.