Recombinant Dictyostelium discoideum Putative lysophosphatidylcholine acyltransferase (taz)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments default to standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
taz; DDB_G0291922; Taffazin; Taz; 1-acylglycerophosphocholine O-acyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-285
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
taz
Target Protein Sequence
MDSNNSNNNNKNLKQICDIPKPQFLSKGVFTLVGVLCKFWISMNTVTTSGIDKLVNEIDK THQLKRPMITIANHSSNLDDPLLWGVLPNRILMDPSKQRWTLGASNILFTNWFYSKFFSL GKCIKIVRGDGIYQDGMNESIDRLSEGQWLHIFPEGRISQQTQLLYFKWGLGRLVGECYR RTGVVPLVVPIYHQGMEKSMPLAKLPIPRVGINLDIKVGDNIYCDQVISKYIDDNKISDL TDYLSQDDKKRKDFYKTITLHIEDEYQKIIPPTNRGRFSHPTIKD
Uniprot No.

Target Background

Function

This acyltransferase is crucial for remodeling newly synthesized cardiolipin (CL), a vital phospholipid in the mitochondrial inner membrane. It modifies CL's acyl chains with tissue-specific variations, essential for optimal mitochondrial function. CL acyl group remodeling impacts the assembly and stability of respiratory chain complex IV and its supercomplexes, highlighting CL's critical role in the co-assembly of lipids and proteins within mitochondrial membranes.

The enzyme catalyzes transacylation between phospholipids and lysophospholipids, exhibiting the highest activity between phosphatidylcholine (PC) and CL. It catalyzes both lysophosphatidylcholine (LPC) reacylation and PC-CL transacylation, exchanging acyl groups between CL and PC through bidirectional transacylations. While exhibiting lower activity, it also catalyzes transacylations between other phospholipids, including phosphatidylethanolamine (PE) and CL, PC and PE, and PC and phosphatidate (PA).

The enzyme is not regiospecific, transferring acyl groups to either the sn-1 or sn-2 positions of monolysocardiolipin (MLCL), ensuring uniform and symmetrical CL acyl distribution. It cannot transacylate dilysocardiolipin (DLCL), limiting MLCL's role to acyl acceptance. This CoA-independent enzyme reshuffles molecular species within a single phospholipid class, redistributing fatty acids between MLCL, CL, and other lipids, thus extending CL's half-life. Its reversible action allows for cyclical changes, such as membrane fission/fusion or bending/flattening. By influencing lipid composition flexibility, it significantly contributes to the dynamics of mitochondrial membranes.

Database Links
Protein Families
Taffazin family
Subcellular Location
Mitochondrion outer membrane; Peripheral membrane protein; Intermembrane side. Mitochondrion inner membrane; Peripheral membrane protein; Intermembrane side.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.