Recombinant Dictyostelium discoideum Putative peroxisome assembly protein 12 (pex12)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.

Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.

Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.

Synonyms
pex12; DDB_G0285523; Putative peroxisome assembly protein 12; Peroxin-12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-459
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
pex12
Target Protein Sequence
MFMFNFDNGHDPNRPSFFEMLNQHQMMPSFKPALKYIFTVLSQRNPKFRYIVNYYDECFY SLLLLLEYHYLKYYEGSFSENFYNLKRIKPRNNNANGDGDTLFSLLKRLVVTPSNAGQGP ETYTKSQILKKSFAMIRRNRAAASSSQQAKDDLNTMIQDSDRKESLIYLVLIPYFKGKLD EYYKKESDPLAELGLVSSDNNNNNNDNINDQIQQLEEQIQQQQTIVNGNNNSNNNNKKLK IKFLILIRFLKGSKTLKKLKTIFLKVYPFISAIYEALFFIYQLLYLYEYTNYYTPFFHFQ NIQLKRLNHKDIESHRVVISNRRRDRINFVRDWPGSSFFVRLVSILDSILDYSKYILPLS VFIFKSLEWWYSENRISAPTLPIPTPPTPSKRAPGGLEIPRDKRLCPLCLKERTNPTICG SGFVFCYPCIFGYVNEHSKCPITFLPTNTEQLRKIYETV
Uniprot No.

Target Background

Function

Essential for protein import into peroxisomes.

Database Links
Protein Families
Pex2/pex10/pex12 family
Subcellular Location
Peroxisome membrane; Single-pass membrane protein.

Q&A

What is the basic structure of Dictyostelium discoideum pex12?

Dictyostelium discoideum putative peroxisome assembly protein 12 (pex12) is a 459 amino acid protein with multiple functional domains. The protein sequence (Uniprot NO.: Q54N40) includes a distinctive zinc-binding domain characterized by the C3HC4 RING finger motif, which is critical for its function in peroxisome biogenesis . The protein contains several signature sequences:

  • N-terminal region with two transmembrane domains

  • Central region with low complexity stretches and asparagine-rich segments

  • C-terminal RING finger domain (CxnCx2CxnCx2C) that mediates protein-protein interactions

The RING finger domain is particularly important as it facilitates ubiquitin ligase activity and interactions with other peroxins in the peroxisome assembly complex.

How does pex12 compare to other peroxins in D. discoideum?

Pex12 functions as part of a broader peroxisomal import machinery that includes other peroxins such as Pex3, Pex10, Pex11, and Pex14. While these proteins work together in peroxisome biogenesis, they serve distinct roles :

PeroxinPrimary FunctionConservationLocalization
Pex12E3 ubiquitin ligase componentCore peroxin across eukaryotesPeroxisomal membrane
Pex3Membrane protein dockingBroadly conservedPeroxisomal membrane
Pex10E3 ubiquitin ligase activityCore peroxinPeroxisomal membrane
Pex11Membrane elongation/divisionMultiple isoformsPeroxisomal membrane
Pex14Matrix protein importBroadly conservedPeroxisomal membrane

Notably, computational analysis reveals that Pex12, along with Pex3, Pex10, and Pex19, is considered an unequivocal in silico marker for peroxisomes, suggesting its essential role in peroxisome formation and maintenance .

What are the optimal storage and handling conditions for recombinant D. discoideum pex12?

For optimal maintenance of protein activity, recombinant D. discoideum pex12 should be stored in a Tris-based buffer with 50% glycerol at -20°C for routine storage, or at -80°C for extended preservation . To minimize activity loss:

  • Avoid repeated freeze-thaw cycles which can lead to protein denaturation

  • Store working aliquots at 4°C for up to one week

  • When thawing, use gentle mixing rather than vortexing to maintain protein integrity

  • Maintain pH stability (typically pH 7.4-8.0) to preserve the zinc-finger domain structure

For experiments requiring extended protein use, consider creating multiple small-volume aliquots rather than repeatedly accessing a single stock tube .

What expression systems are most effective for producing recombinant D. discoideum pex12?

Based on research practices, several expression systems have been successfully implemented for D. discoideum pex12 production, each with distinct advantages:

Expression SystemAdvantagesChallengesYield
E. coli (BL21)Rapid growth, high yieldPotential improper folding of transmembrane regionsModerate
Yeast (S. cerevisiae)Post-translational modifications, proper membrane protein foldingLonger expression timeGood
Insect cells (Sf9)Eukaryotic processing, glycosylationComplex media requirementsHigh
D. discoideum itselfNative folding environmentLower yield, specialized growth conditionsVariable

For functional studies, the yeast expression system has shown particular utility as demonstrated by successful incorporation of related peroxins like MbPex14 into S. cerevisiae peroxisomes . This approach allows verification of proper folding and targeting. When expressing in heterologous systems, optimizing codon usage for the host organism significantly improves expression efficiency.

How can researchers effectively study pex12 localization in D. discoideum cells?

To study pex12 localization in D. discoideum, researchers should employ a multi-method approach combining:

  • Fluorescence microscopy with tagged proteins:

    • Express pex12 with a fluorescent tag (GFP or mCherry)

    • Co-express with established peroxisomal markers

    • Use confocal microscopy for high-resolution imaging

  • Subcellular fractionation and immunoblotting:

    • Separate cellular components through differential centrifugation

    • Identify pex12 in fractions using specific antibodies

    • Compare distribution with known peroxisomal markers

  • Immunoelectron microscopy:

    • Use gold-labeled antibodies against pex12

    • Visualize exact subcellular localization at ultrastructural level

Recent research demonstrates the value of combining these approaches, as illustrated in studies of peroxisomal proteins like Pex14, where both microscopy and biochemical analysis confirmed peroxisomal localization . When designing experiments, consider controls using mutant strains lacking other peroxins to assess dependency relationships in targeting.

What phenotypes are observed in D. discoideum cells with pex12 dysfunction?

Disruption of pex12 function in D. discoideum leads to several observable phenotypes related to peroxisome dysfunction:

  • Morphological changes:

    • Absence or abnormal appearance of peroxisomes

    • Mislocalization of peroxisomal matrix proteins

    • Altered cell size and shape

  • Metabolic defects:

    • Impaired fatty acid β-oxidation

    • Disrupted reactive oxygen species metabolism

    • Altered lipid composition

  • Developmental abnormalities:

    • Delayed or aberrant multicellular development

    • Compromised aggregation during starvation response

    • Altered cell motility and chemotaxis

These phenotypes can be quantified through growth rate measurements, developmental timing assays, and metabolic pathway analysis . Interestingly, comparative analysis with mitochondrial dysfunction models shows distinct phenotypic patterns, suggesting specific cellular signaling pathways are activated in response to peroxisomal versus mitochondrial defects .

How does D. discoideum pex12 differ from homologs in other organisms?

D. discoideum pex12 displays both conserved features and unique characteristics compared to homologs in other species:

OrganismProtein SizeDomain ConservationUnique Features
D. discoideum459 aaC-terminal RING domainAsparagine-rich regions
H. sapiens359 aaC-terminal RING domainExtended C-terminus
S. cerevisiae399 aaC-terminal RING domainExtended N-terminus
M. balamuthi412 aaC-terminal RING domainAdapted to anaerobic conditions

A particularly interesting comparison is with Mastigamoeba balamuthi, another amoeboid protist that has adapted its peroxisomes to function under anaerobic conditions . While both D. discoideum and M. balamuthi express pex12, the functional adaptations of these proteins reflect their evolutionary divergence and metabolic specializations.

The core RING finger domain remains highly conserved across species, suggesting its critical importance in protein function, while the variable regions may confer species-specific regulatory properties or interaction specificities .

What insights can D. discoideum pex12 provide for understanding human peroxisomal disorders?

D. discoideum offers valuable insights into human peroxisomal biogenesis disorders (PBDs) through its simplified but conserved peroxisomal machinery:

  • Zellweger spectrum disorders:

    • Mutations in human PEX12 cause Zellweger syndrome and related disorders

    • D. discoideum pex12 knockouts can model fundamental aspects of these conditions

    • Simplified genetic background allows clearer interpretation of pathogenic mechanisms

  • Therapeutic development opportunities:

    • High-throughput screening of compounds affecting pex12 function

    • Identification of genetic modifiers that suppress pex12 deficiency phenotypes

    • Testing of potential protein replacement therapies

  • Evolutionary conservation analysis:

    • Identification of functionally critical residues through comparative genomics

    • Development of predictive models for human PEX12 mutation pathogenicity

D. discoideum's advantages as a model system include its haploid genome, ease of genetic manipulation, and ability to be studied in both unicellular and multicellular states . Recent studies have demonstrated the utility of D. discoideum for modeling various neurodegenerative diseases, suggesting similar approaches could be applied to peroxisome biogenesis disorders .

How can researchers use pex12 to study peroxisome-mitochondria interactions in D. discoideum?

Investigating peroxisome-mitochondria interactions through pex12 requires sophisticated experimental approaches:

  • Proximity labeling techniques:

    • Express pex12 fused to enzymes like APEX2 or BioID

    • Identify proteins in proximity to pex12 using mass spectrometry

    • Map the peroxisome-mitochondria interactome

  • Live-cell imaging approaches:

    • Dual labeling of peroxisomes (via pex12-FP) and mitochondria

    • Time-lapse microscopy to track organelle dynamics and interactions

    • Super-resolution microscopy to visualize contact sites

  • Functional assays:

    • Measure metabolite exchange between organelles in wild-type and pex12-mutant cells

    • Assess calcium signaling between peroxisomes and mitochondria

    • Evaluate redox state changes during organelle interaction

Recent studies in other organisms have revealed that peroxins like pex11 can be mislocalized to mitochondria in the absence of certain peroxisome assembly factors , suggesting complex crosstalk between these organelles. In D. discoideum, which has been established as a model for mitochondrial dysfunction , similar studies focusing on pex12 could reveal unique aspects of organelle communication in this evolutionarily distinct organism.

What role does pex12 play in unconventional peroxisome biogenesis pathways?

Recent research suggests pex12 may function in previously unrecognized peroxisome biogenesis pathways:

  • De novo peroxisome formation:

    • Evidence suggests pex12 may participate in peroxisome formation from the ER

    • Studies of pex12 localization during peroxisome proliferation can reveal temporal dynamics

    • Investigation of pex12 interactions with early peroxisome assembly factors like pex3 and pex19

  • Pexophagy regulation:

    • Potential role of pex12's ubiquitin ligase activity in marking peroxisomes for degradation

    • Analysis of peroxisome turnover rates in pex12 mutants with varying levels of dysfunction

    • Examination of pex12 post-translational modifications during cellular stress

  • Non-canonical functions:

    • Exploration of potential roles beyond peroxisome assembly

    • Investigation of transcriptional regulation in response to pex12 activity

    • Analysis of potential cytosolic functions of pex12 fragments

Emerging research in M. balamuthi revealed the existence of anaerobic peroxisomes , challenging the traditional view that peroxisomes primarily serve oxidative functions. This discovery opens new questions about the evolutionary adaptability of the peroxisome biogenesis machinery, including pex12, suggesting it may have broader functionality than previously recognized.

How can researchers overcome difficulties in purifying functional recombinant pex12?

Purification of functional recombinant pex12 presents several challenges due to its membrane-associated nature and multiple domains. Researchers should consider these strategies:

  • Optimized solubilization approaches:

    • Test multiple detergents (DDM, CHAPS, digitonin) for optimal extraction

    • Consider amphipol substitution for long-term stability

    • Evaluate nanodiscs for maintaining native-like membrane environment

  • Fusion protein strategies:

    • N-terminal GST or MBP tags to enhance solubility

    • Self-cleaving intein systems for tag removal without proteases

    • Split-GFP complementation to verify proper folding

  • Expression optimization:

    • Temperature reduction during induction (16-20°C)

    • Co-expression with chaperones (GroEL/ES, DnaK/J)

    • Controlled expression rate using titratable promoters

Successful purification protocols typically employ a combination of affinity chromatography followed by size exclusion chromatography, with careful attention to buffer composition to maintain the integrity of the zinc-finger domain .

What approaches can resolve conflicting data about pex12 localization and function?

When faced with conflicting data about pex12 localization and function, researchers should implement these resolution strategies:

  • Methodological reconciliation:

    • Compare experimental conditions (cell fixation, buffer composition, antibody specificity)

    • Evaluate tag interference by testing multiple tag positions and types

    • Apply complementary techniques (biochemical fractionation, microscopy, proximity labeling)

  • Genetic background considerations:

    • Assess influence of strain differences on localization patterns

    • Create clean genetic backgrounds to eliminate confounding mutations

    • Use CRISPR-Cas9 for precise genome editing rather than overexpression systems

  • Functional validation:

    • Perform rescue experiments with variant constructs

    • Conduct domain swapping to identify critical regions

    • Implement rapid protein degradation systems (AID, dTAG) for acute functional analysis

Research on peroxins in different organisms has sometimes yielded seemingly contradictory results. For example, studies in yeast showed that Pex11 localizes to mitochondria in pex3 and pex19 mutants, while in H. polymorpha pex3 cells, Pex11 localizes to the ER . These discrepancies highlight the importance of careful experimental design and validation across multiple approaches.

What emerging technologies could advance our understanding of pex12 function?

Several cutting-edge technologies show promise for deepening our understanding of pex12 function:

  • Cryo-electron microscopy:

    • Determine high-resolution structure of pex12 in membrane environment

    • Visualize pex12 interactions within the peroxisome import complex

    • Map conformational changes during protein function

  • Optogenetic approaches:

    • Control pex12 activity with light-inducible domains

    • Manipulate peroxisome formation in real-time

    • Study acute effects of pex12 activation/inactivation

  • Single-molecule studies:

    • Track individual pex12 molecules during peroxisome biogenesis

    • Measure binding kinetics with interaction partners

    • Determine stoichiometry of functional complexes

  • Multi-omics integration:

    • Combine proteomics, metabolomics, and lipidomics to create comprehensive models

    • Identify previously unknown substrates and regulatory pathways

    • Map peroxisome-associated interaction networks

The application of these technologies to D. discoideum pex12 research could reveal novel aspects of peroxisome biology that are conserved across evolution and provide insights into fundamental cellular processes.

How might understanding D. discoideum pex12 contribute to synthetic biology applications?

Research on D. discoideum pex12 could enable several innovative synthetic biology applications:

  • Engineered organelles:

    • Design minimal synthetic peroxisomes using pex12 and core peroxins

    • Create specialized metabolic compartments for biotechnology

    • Develop controllable protein targeting systems

  • Biosensor development:

    • Use pex12-based systems to detect peroxisome proliferation

    • Engineer stress-responsive peroxisome assembly

    • Create reporters for peroxisomal import efficiency

  • Therapeutic strategies:

    • Design peptide inhibitors of pathogenic protein-protein interactions

    • Develop peroxisome-targeted drug delivery systems

    • Create cell lines with enhanced detoxification capabilities

Recent bacteriolytic activity studies in D. discoideum provide a template for how cellular compartmentalization can enhance specific biochemical activities . Applying similar principles to engineered peroxisomes could create new tools for bioremediation, biocatalysis, and medical applications.

What controls are essential when studying pex12 function in D. discoideum?

Robust experimental design for studying pex12 requires comprehensive controls:

  • Expression level controls:

    • Compare endogenous vs. overexpressed protein

    • Use inducible promoters to titrate expression

    • Quantify protein levels across experimental conditions

  • Localization controls:

    • Include known peroxisomal markers (matrix and membrane)

    • Use markers for other organelles to rule out mislocalization

    • Empty vector controls for tagged constructs

  • Functional validation controls:

    • Wild-type protein complementation

    • Domain-specific mutants

    • Interspecies complementation tests

  • Technical controls:

    • Multiple fixation methods for microscopy

    • Different subcellular fractionation techniques

    • Antibody specificity verification

Research on bacteriolytic activities in D. discoideum demonstrated the importance of pH controls, as certain activities were only detected at specific pH values mimicking phagosomal conditions . Similar considerations may apply to peroxisomal proteins, highlighting the importance of physiologically relevant experimental conditions.

What are the best approaches to study pex12 interactions with the peroxisomal importomer complex?

To effectively study pex12 interactions within the peroxisomal importomer complex:

  • In vivo interaction studies:

    • Bimolecular Fluorescence Complementation (BiFC)

    • Förster Resonance Energy Transfer (FRET)

    • Proximity-dependent biotin labeling (BioID, APEX)

  • Biochemical approaches:

    • Co-immunoprecipitation with crosslinking

    • Blue native PAGE for intact complexes

    • Size exclusion chromatography combined with multi-angle light scattering

  • Structural biology methods:

    • Hydrogen-deuterium exchange mass spectrometry

    • Cross-linking mass spectrometry

    • Single-particle cryo-EM of purified complexes

  • Functional reconstitution:

    • Liposome reconstitution assays

    • Cell-free expression systems

    • Permeabilized cell systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.