Recombinant Dictyostelium discoideum Putative transmembrane protein DDB_G0267530 (DDB_G0267530)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
DDB_G0267530; Putative transmembrane protein DDB_G0267530
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-210
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0267530
Target Protein Sequence
MGVEDQPQTQPQTQPQQQPQMGYQPQMGYQPQAQMGYQPQAAPMGYPQQPIYQQQPQMGY QPPMGYQPQVGYQQQPPQPVYQTYCHDDHQPLLHANVVVTTTQPTVIRKSNSNEETAAVI VFIIGFFFSIVWLGGFFFIKSKSKTARTFGILSVVFFFLVLVIVVIVVSVTVTAAEKIAE ENKDYYYSTSTGYYSTTGYYSTTTSYTTYY
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Dictyostelium discoideum and why is it used as a model organism?

Dictyostelium discoideum is a soil-dwelling, social amoeba that serves as an established model organism for studying fundamental cellular processes. This organism offers several experimental advantages in research settings, including a haploid genome that facilitates genetic manipulation, ease of cultivation in laboratory conditions, and a unique life cycle with both unicellular and multicellular stages. D. discoideum has gained significant traction as a model system because it shares numerous cellular pathways with mammalian cells while offering simpler experimental accessibility.

The organism has proven particularly valuable for investigating phagocytosis, macropinocytosis, chemotaxis, and autophagy - all cellular processes highly conserved between D. discoideum and mammalian phagocytic cells of the mononuclear phagocyte system (MPS) . Its genome encodes multiple homologs of proteins involved in microbial sensing and response pathways found in macrophages, making it an excellent model for host-pathogen interaction studies . The multicellular development stage of D. discoideum also provides insights into intercellular signaling, cell fate determination, and tissue patterning mechanisms .

What experimental systems are available for studying DDB_G0267530 expression and function?

Several experimental systems and approaches are available for investigating DDB_G0267530 expression and function:

  • Recombinant protein expression systems: The protein can be produced as a recombinant product in E. coli expression systems with affinity tags (commonly His-tags) for purification purposes . These systems enable production of sufficient quantities for biochemical and structural characterization.

  • Genetic manipulation in D. discoideum: The haploid genome of D. discoideum facilitates genetic approaches including gene knockout, knockdown, or overexpression studies. An extensive molecular genetic toolkit has been developed for D. discoideum, allowing for targeted gene modifications and ectopic expression .

  • Cellular localization studies: Fluorescently tagged versions of the protein can be expressed in D. discoideum to visualize subcellular localization using confocal microscopy. The organism is well-suited for microscopy including live-cell imaging techniques .

  • Infection models: D. discoideum serves as a host for various intracellular pathogens including Legionella pneumophila, Mycobacterium species, and Pseudomonas aeruginosa . These models can be used to investigate potential roles of DDB_G0267530 in host-pathogen interactions.

  • Developmental studies: The multicellular development cycle of D. discoideum provides opportunities to investigate potential stage-specific expression or functions of DDB_G0267530 throughout the organism's life cycle .

How should experiments be designed to investigate potential interaction partners of DDB_G0267530?

Investigating protein-protein interactions for DDB_G0267530 requires a multi-faceted experimental approach:

Co-immunoprecipitation (Co-IP) experiments:

  • Express epitope-tagged versions of DDB_G0267530 (e.g., FLAG, HA, or His-tag) in D. discoideum.

  • Perform cell lysis under conditions that preserve protein-protein interactions (mild detergents, physiological salt concentrations).

  • Use antibodies against the tag to precipitate DDB_G0267530 along with interacting proteins.

  • Analyze precipitated proteins using mass spectrometry to identify potential binding partners.

  • Validate interactions through reciprocal Co-IPs and control experiments with mutated versions of the protein.

This approach has been successfully employed to identify protein interactions in D. discoideum, as demonstrated in similar studies with other proteins like NME1 and DNM2 .

Yeast two-hybrid screening:

  • Generate a fusion construct of DDB_G0267530 with a DNA-binding domain.

  • Screen against a D. discoideum cDNA library fused to an activation domain.

  • Select for positive interactions through reporter gene activation.

  • Validate positive hits through secondary screening methods.

Proximity-based labeling approaches:

  • Generate fusion proteins of DDB_G0267530 with enzymes like BioID or APEX2.

  • Express these constructs in D. discoideum.

  • Allow biotinylation of proximal proteins upon addition of biotin.

  • Purify biotinylated proteins and identify them by mass spectrometry.

Each approach has specific advantages and limitations that should be considered in the experimental design. For example, Co-IP is best suited for stable interactions, while proximity labeling can capture more transient associations .

What are the key considerations for designing experiments to localize DDB_G0267530 in cellular compartments?

Effective subcellular localization studies for DDB_G0267530 require careful experimental design considerations:

Fluorescent protein fusion constructs:

  • Generate both N- and C-terminal fusion constructs, as the tag position may affect localization or function.

  • Use monomeric fluorescent proteins (e.g., mEGFP, mCherry) to minimize artifacts from fluorophore oligomerization.

  • Include flexible linker sequences between DDB_G0267530 and the fluorescent tag.

  • Validate expression levels using Western blotting to ensure they are not grossly over-physiological.

Colocalization studies:

  • Select appropriate markers for cellular compartments (e.g., ER, Golgi, plasma membrane, endosomes, lysosomes).

  • Perform dual-color imaging with established compartment markers.

  • Quantify colocalization using statistical measures like Pearson's correlation coefficient.

Fractionation approaches:

  • Perform subcellular fractionation of D. discoideum cells.

  • Analyze fractions by Western blotting using antibodies against DDB_G0267530.

  • Compare distribution with known markers of cellular compartments.

  • Use density gradient centrifugation (e.g., Percoll gradients) to resolve vesicular compartments.

The selection of appropriate organelle markers is crucial, particularly given D. discoideum's distinct acid hydrolase-containing vesicle populations with different densities (1.07 and 1.13 g/ml) . When analyzing membrane proteins, differential detergent extraction can provide additional information about membrane association characteristics.

How can researchers effectively design experiments to investigate the role of DDB_G0267530 in D. discoideum development?

Investigating developmental roles requires stage-specific analysis approaches:

Expression profiling across developmental stages:

  • Collect D. discoideum samples at key developmental timepoints (vegetative growth, aggregation, mound formation, slug formation, and culmination).

  • Extract RNA for RT-qPCR analysis of DDB_G0267530 expression.

  • Alternatively, perform Western blotting to assess protein levels at different stages.

  • Compare expression patterns with known developmental markers.

Gene disruption and phenotypic analysis:

  • Generate DDB_G0267530 knockout strains using CRISPR-Cas9 or homologous recombination.

  • Evaluate growth rates during vegetative phase.

  • Assess developmental progression under standard starvation conditions.

  • Document potential defects in timing or morphology of developmental structures.

  • Analyze spore formation efficiency and viability.

Spatiotemporal expression analysis:

  • Create reporter constructs with the DDB_G0267530 promoter driving fluorescent protein expression.

  • Monitor reporter activity throughout development using time-lapse imaging.

  • Determine if expression is uniform or restricted to specific cell types (e.g., prespore vs. prestalk cells).

When analyzing developmental phenotypes, it's important to consider that D. discoideum cells undergo significant reorganization during development, including changes in vesicle populations. The appearance of a distinct, higher-density (1.13 g/ml) acid hydrolase-containing vesicle population during aggregation may be relevant if DDB_G0267530 associates with these compartments.

How can researchers apply experimental design principles to investigate potential roles of DDB_G0267530 in host-pathogen interactions?

Investigating the role of DDB_G0267530 in host-pathogen interactions requires systematic experimental design:

Infection assays with genetically modified strains:

  • Generate DDB_G0267530 knockout and overexpression strains of D. discoideum.

  • Infect these strains with relevant pathogens (e.g., Legionella pneumophila, Mycobacterium species).

  • Quantify bacterial uptake, survival, and replication within host cells.

  • Assess host cell survival and cytokine-like responses.

Localization during infection:

  • Express fluorescently tagged DDB_G0267530 in D. discoideum.

  • Infect with fluorescently labeled pathogens.

  • Monitor potential recruitment or exclusion of DDB_G0267530 from pathogen-containing compartments.

  • Perform time-lapse imaging to capture dynamic localization changes.

Comparative analysis with known defense proteins:

  • Compare phenotypes of DDB_G0267530-deficient cells with those lacking established immunity proteins.

  • Investigate potential interactions with known host defense factors.

  • Assess whether pathogen effectors target DDB_G0267530 during infection.

D. discoideum serves as an excellent model for studying cell-autonomous defenses against pathogens, with established protocols for infection with various bacterial pathogens . The conservation of phagocytosis and autophagy pathways between D. discoideum and mammalian cells makes findings potentially translatable to human host defense mechanisms.

What methodological approaches should be employed to resolve contradictions in experimental data related to DDB_G0267530?

Resolving contradictions in experimental data requires a structured analytical approach:

Systematic analysis of contradiction patterns:

  • Categorize contradictions using a formal notation system that considers:

    • The number of interdependent items (α)

    • The number of contradictory dependencies defined by domain experts (β)

    • The minimal number of required Boolean rules to assess these contradictions (θ)

  • Apply Boolean minimization techniques to reduce complex contradiction patterns to their essential components.

  • Develop a structured classification of contradiction checks.

Experimental validation strategies:

  • Reproduce experiments under standardized conditions.

  • Systematically vary experimental parameters to identify condition-dependent effects.

  • Utilize complementary methodologies to address the same research question.

  • Consider biological variability and statistical power in experimental design.

Analysis of technical versus biological variables:

  • Distinguish between contradictions arising from technical artifacts versus genuine biological phenomena.

  • Control for expression levels, tag interference, and cellular stress responses.

  • Consider post-translational modifications and protein isoforms.

  • Evaluate strain-specific genetic variations that may influence results.

When analyzing contradictory data about transmembrane proteins like DDB_G0267530, it's important to consider that experimental conditions (detergents, buffer compositions, fixation methods) can dramatically influence results . A structured classification of contradiction patterns helps manage the complexity of multidimensional interdependencies within datasets.

How can structure-function relationships of DDB_G0267530 be systematically investigated?

A comprehensive structure-function analysis requires a multi-level experimental approach:

Domain mapping and mutagenesis:

  • Perform in silico analysis to predict functional domains, transmembrane regions, and potential modification sites.

  • Generate truncation constructs targeting specific domains.

  • Introduce point mutations at conserved residues or predicted functional sites.

  • Assess the effects of mutations on localization, protein interactions, and cellular functions.

Evolutionary conservation analysis:

  • Identify homologs across species (e.g., the identified homolog in Acanthaster planci) .

  • Perform phylogenetic analysis to trace evolutionary relationships.

  • Identify highly conserved residues that may be functionally critical.

  • Test the functional equivalence of homologs through cross-species complementation experiments.

Structural characterization approaches:

  • Express and purify domains for structural studies using X-ray crystallography or NMR.

  • Apply cryo-electron microscopy for larger assemblies or membrane-embedded regions.

  • Use computational prediction tools including AI-based approaches like AlphaFold2 for structure prediction .

  • Validate structural predictions through targeted biochemical experiments.

For transmembrane proteins, structural studies present particular challenges due to their hydrophobic nature. Approaches may include the use of detergent micelles, nanodiscs, or lipidic cubic phases to maintain native-like environments during purification and analysis .

What statistical approaches are appropriate for analyzing subcellular localization data for DDB_G0267530?

Rigorous statistical analysis of localization data requires:

Quantitative colocalization analysis:

  • Calculate standard colocalization metrics:

    • Pearson's correlation coefficient (measures linear correlation)

    • Manders' overlap coefficients (measures fractional overlap)

    • Costes method for statistically significant colocalization

  • Perform object-based colocalization for vesicular structures.

  • Use randomization tests to determine statistical significance by comparing observed colocalization to randomized distributions.

Colocalization MetricInterpretation RangeStrength of Association
Pearson's Coefficient-1 to +1<0.3: weak, 0.3-0.7: moderate, >0.7: strong
Manders' Coefficient M10 to 1<0.3: minimal, 0.3-0.7: partial, >0.7: high
Manders' Coefficient M20 to 1<0.3: minimal, 0.3-0.7: partial, >0.7: high

Spatial distribution analysis:

  • Measure distances from reference structures (e.g., plasma membrane, nuclear envelope).

  • Generate intensity profiles across cellular regions.

  • Apply spatial statistics (e.g., Ripley's K function) to characterize distribution patterns.

  • Use probability distributions to model localization patterns.

Dynamic localization analysis:

  • Track protein movement using time-lapse imaging.

  • Calculate diffusion coefficients and mobility fractions.

  • Identify directed movement versus random diffusion.

  • Quantify residence times in specific compartments.

When analyzing transmembrane protein localization, it's essential to account for the inherent constraints of membrane systems, which may create apparent colocalization simply due to membrane proximity rather than specific functional association.

How should researchers design and analyze experiments to determine if DDB_G0267530 undergoes post-translational modifications?

Post-translational modification analysis requires specialized approaches:

Mass spectrometry-based identification:

  • Immunoprecipitate DDB_G0267530 from D. discoideum cells.

  • Process samples for mass spectrometry analysis.

  • Perform targeted searches for common modifications (phosphorylation, glycosylation, ubiquitination).

  • Compare modification patterns under different conditions (e.g., growth phase, starvation, infection).

Biochemical detection methods:

  • Use phospho-specific staining (e.g., Pro-Q Diamond) to detect phosphorylation.

  • Apply glycan-specific stains or lectins to detect glycosylation.

  • Perform Western blotting with modification-specific antibodies.

  • Evaluate mobility shifts in gel electrophoresis following treatment with modification-removing enzymes.

Site-directed mutagenesis validation:

  • Identify putative modification sites through predictive algorithms or mass spectrometry.

  • Generate site-specific mutants (e.g., Y→F for phosphotyrosine sites).

  • Assess functional consequences of preventing specific modifications.

  • Create phosphomimetic mutations (e.g., S→D or S→E) to simulate constitutive phosphorylation.

For transmembrane proteins like DDB_G0267530, certain modifications (particularly glycosylation) may be essential for proper folding, trafficking, or function. The protein's C-terminal region, rich in tyrosine residues, presents potential sites for phosphorylation that may regulate its activity or interactions .

What experimental design is optimal for determining the topology of DDB_G0267530 in membranes?

Determining membrane protein topology requires specialized approaches:

Protease protection assays:

  • Isolate membrane fractions containing DDB_G0267530.

  • Treat intact vesicles with proteases (e.g., trypsin, proteinase K).

  • Assess which regions are protected from digestion (inside vesicles) versus exposed (outside).

  • Compare results with and without membrane permeabilization.

Epitope insertion and accessibility:

  • Generate constructs with epitope tags inserted at various positions.

  • Assess accessibility of tags to antibodies in permeabilized versus non-permeabilized cells.

  • Map accessible versus inaccessible regions to determine topology.

Fluorescence-based approaches:

  • Use pH-sensitive fluorescent proteins (e.g., pHluorin) inserted at different positions.

  • Exploit pH differences between cellular compartments to determine orientation.

  • Apply fluorescence protease protection (FPP) assays to determine topology.

In silico prediction validation:

  • Compare experimental results with topology predictions from algorithms like TMHMM, Phobius, or TOPCONS.

  • Resolve discrepancies through additional targeted experiments.

MethodAdvantagesLimitationsData Interpretation
Protease ProtectionDirect biochemical evidenceRequires specific antibodiesProtected fragments indicate luminal domains
Epitope InsertionCan map multiple sitesTags may disrupt foldingAccessible without permeabilization = extracellular
Fluorescence-basedLive cell analysis possibleLimited to specific positionsSignal changes indicate compartment exposure

The current prediction for DDB_G0267530 suggests a single transmembrane domain, but experimental validation is essential to confirm this topology and determine which regions face the cytosol versus the lumen/extracellular space.

How can researchers leverage D. discoideum as a model system to study the evolutionary conservation of DDB_G0267530 function?

Evolutionary function analysis requires comparative approaches:

Cross-species complementation studies:

  • Identify homologs of DDB_G0267530 in other species (e.g., the Acanthaster planci homolog) .

  • Generate D. discoideum strains with the endogenous DDB_G0267530 gene replaced by homologs.

  • Assess whether heterologous expression restores wild-type phenotypes in knockout strains.

  • Identify conserved versus species-specific functions through detailed phenotypic analysis.

Domain conservation analysis:

  • Perform multiple sequence alignments of homologs from diverse species.

  • Identify highly conserved motifs or residues.

  • Generate chimeric proteins containing domains from different species' homologs.

  • Test functionality of chimeric proteins to map critical domains.

Comparative interactome studies:

  • Identify interaction partners of DDB_G0267530 in D. discoideum.

  • Determine if homologous proteins in other species maintain the same interactions.

  • Map the evolution of protein-protein interaction networks involving this protein family.

The evolutionary analysis is particularly interesting given the identification of a homolog in Acanthaster planci (crown-of-thorns starfish) , suggesting conservation across considerable evolutionary distance. This conservation may indicate fundamental cellular functions that have been maintained throughout eukaryotic evolution.

What approaches can researchers use to develop high-throughput screening methods for identifying compounds that modulate DDB_G0267530 function?

Developing screening assays requires clear functional readouts:

Phenotypic screening approaches:

  • Identify a robust phenotype associated with DDB_G0267530 disruption.

  • Develop assays compatible with high-throughput formats (e.g., growth, development, resistance to pathogens).

  • Optimize for miniaturization in multi-well plate formats.

  • Include appropriate controls for hit validation.

Fluorescence-based interaction assays:

  • Develop FRET or BiFC assays using DDB_G0267530 and confirmed interaction partners.

  • Screen for compounds that disrupt or enhance these interactions.

  • Implement image-based high-content screening for localization changes.

  • Design split-reporter systems for monitoring protein-protein interactions.

Target-based biochemical assays:

  • Express and purify recombinant DDB_G0267530 protein.

  • Develop biochemical assays if enzymatic activities are identified.

  • Create binding assays with identified ligands or interaction partners.

  • Screen compound libraries for modulators of these activities.

D. discoideum is well-suited for high-throughput screening, with established protocols already developed for drug discovery screens . The availability of recombinant DDB_G0267530 protein provides a resource for developing target-based screening approaches alongside cell-based assays.

How can researchers design experiments to investigate the potential role of DDB_G0267530 in membrane trafficking and vesicle transport?

Membrane trafficking studies require specialized approaches:

Cargo trafficking assays:

  • Identify potential cargo molecules transported in DDB_G0267530-positive compartments.

  • Generate fluorescently tagged cargo markers.

  • Monitor trafficking kinetics in wild-type versus DDB_G0267530-deficient cells.

  • Use temperature blocks or drug treatments to synchronize trafficking events.

Vesicle isolation and characterization:

  • Fractionate D. discoideum cells using density gradient centrifugation.

  • Identify fractions containing DDB_G0267530.

  • Characterize these vesicles through proteomic and lipidomic analysis.

  • Compare with known vesicle populations, particularly the distinct acid hydrolase-containing vesicles (densities of 1.07 and 1.13 g/ml) .

Live imaging of vesicle dynamics:

  • Express fluorescently tagged DDB_G0267530 in D. discoideum.

  • Perform high-speed confocal or TIRF microscopy to track vesicle movement.

  • Quantify parameters such as vesicle velocity, directionality, and fusion events.

  • Compare dynamics in cells treated with cytoskeletal inhibitors or membrane trafficking disruptors.

This approach is particularly relevant given that D. discoideum contains distinct populations of acid hydrolase-containing vesicles that emerge during development . Determining whether DDB_G0267530 associates with these specialized vesicles could provide insights into its functional role during the organism's life cycle.

What are the most promising research directions for understanding DDB_G0267530 function in cellular physiology?

Based on current knowledge and technical capabilities, several research directions stand out:

  • Detailed characterization of protein interactions and complexes: Identifying the interaction partners of DDB_G0267530 will provide critical insights into its cellular functions. Techniques such as proximity labeling, co-immunoprecipitation followed by mass spectrometry, and yeast two-hybrid screening offer complementary approaches to building a comprehensive interactome.

  • Functional analysis during D. discoideum development: The multicellular development cycle of D. discoideum provides a unique context to study potential stage-specific functions. Investigating whether DDB_G0267530 plays roles in cell differentiation, morphogenesis, or the formation of specialized structures would connect its molecular functions to organismal development.

  • Systematic structure-function analysis: Leveraging advances in protein structure prediction (such as AlphaFold2) combined with targeted mutagenesis approaches can reveal critical structural features and functional domains. This approach could identify specific residues or motifs essential for localization, interactions, or activity.

  • Investigation of roles in host-pathogen interactions: Given D. discoideum's established role as a model for studying interactions with bacterial pathogens, examining potential functions of DDB_G0267530 during infection could reveal novel aspects of cell-autonomous defense mechanisms or pathogen manipulation strategies.

These directions build upon the established experimental systems and take advantage of D. discoideum's unique features as a model organism while addressing fundamental questions about cellular physiology.

How should researchers integrate multiple experimental approaches to build a comprehensive understanding of DDB_G0267530?

Developing a comprehensive understanding requires integration of diverse experimental approaches:

  • Multi-level analysis framework: Design experiments that span from molecular interactions to cellular functions to organismal phenotypes. This hierarchical approach connects biochemical properties to biological significance.

  • Complementary methodology adoption: Combine genetic approaches (knockouts, mutations) with biochemical techniques (protein purification, interaction studies) and cell biological methods (localization, trafficking assays). Each approach addresses different aspects of protein function and provides independent validation.

  • Temporal dynamics investigation: Study DDB_G0267530 across different time scales, from rapid responses to stimuli (seconds to minutes) to developmental transitions (hours to days). This temporal dimension can reveal different functional roles depending on cellular context.

  • Comparative analysis with related proteins: Investigate potential functional redundancy or specialization by examining related proteins in D. discoideum and homologs in other species. This evolutionary perspective can highlight conserved core functions versus species-specific adaptations.

  • Data integration using computational approaches: Apply bioinformatic and systems biology approaches to integrate diverse experimental datasets. Network analysis, pathway modeling, and machine learning can help identify patterns and generate testable hypotheses from complex data.

This integrated approach maximizes the value of individual experiments and builds a more robust understanding by addressing the limitations of any single experimental methodology.

What technological advances would most benefit research on DDB_G0267530 and similar transmembrane proteins?

Several technological developments would significantly advance research in this area:

  • Improved methods for membrane protein structural analysis: Advances in cryo-electron microscopy, native mass spectrometry, and computational prediction tools will provide better structural insights into transmembrane proteins like DDB_G0267530 . These structures are critical for understanding function and designing targeted experiments.

  • Enhanced genome editing tools for D. discoideum: Further refinement of CRISPR-Cas9 and related technologies for precise, efficient gene manipulation in D. discoideum would accelerate functional studies. Development of conditional knockout or degradation systems would be particularly valuable for essential genes.

  • Advanced imaging technologies: Super-resolution microscopy techniques adapted for D. discoideum would enable visualization of protein localization and dynamics at nanometer resolution. Correlative light and electron microscopy could connect protein localization to ultrastructural context.

  • Single-cell analysis methods: Development of single-cell transcriptomics and proteomics approaches for D. discoideum would reveal cell-to-cell variability and heterogeneity, particularly during development when cell differentiation occurs.

  • In situ structural methods: Techniques like proximity labeling combined with cross-linking mass spectrometry could reveal the structural organization of DDB_G0267530 and its interaction partners in their native cellular environment.

These technological advances would overcome current limitations in studying transmembrane proteins and provide new insights into their functions in cellular physiology and development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.