Recombinant Dictyostelium discoideum Putative transmembrane protein DDB_G0277665 (DDB_G0277665)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.

Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.

The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.

Synonyms
DDB_G0277665; Putative transmembrane protein DDB_G0277665
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-150
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0277665
Target Protein Sequence
MIKTLIIIIVSVIVGYLISHFNILNFVISSLIEVTVINNKKVIVGAIVGQALIYFFVFFL PLSSVANQIVKEESSTNYRVNPPKTPSLVGNLYLQQQLQQQQQQQQQLQQQQQQQQQSHH QPILNTATPFTLQNHLIPNPSIKTTQYNIK
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Dictyostelium discoideum DDB_G0277665 and why is it of research interest?

Dictyostelium discoideum DDB_G0277665 is a putative transmembrane protein consisting of 150 amino acids . The interest in this protein stems from D. discoideum's established value as a biomedical model organism. As recognized by the National Institute of Health, D. discoideum shares similarities in cell structure, behavior, and intracellular signaling with mammalian cells, making its proteins potentially relevant for understanding human cellular processes .

The transmembrane nature of DDB_G0277665 suggests it may play a role in cellular communication, signaling pathways, or transport functions. Though its specific function remains to be fully characterized, studying this protein can contribute to our understanding of membrane protein biology in a tractable model system with relevance to human cell biology. D. discoideum's haploid genome and genetic tractability make it particularly valuable for protein function studies .

How does the structure of DDB_G0277665 compare to similar transmembrane proteins in other model organisms?

While detailed structural information specific to DDB_G0277665 is limited in current literature, methodological approaches to this question would involve:

  • Sequence alignment and phylogenetic analysis to identify potential homologs in other organisms

  • Hydropathy plot analysis to predict transmembrane domains

  • Secondary structure prediction using computational tools

  • Comparison with known transmembrane protein families

D. discoideum has been found to share a significant number (approximately 22%) of disease-related gene orthologs with humans, comparable to what is found in D. melanogaster and C. elegans . This suggests that transmembrane proteins like DDB_G0277665 may have structural similarities to human counterparts. Researchers interested in structural comparison should consider combining in silico analysis with experimental techniques such as circular dichroism or, for more detailed structural information, X-ray crystallography or cryo-electron microscopy.

What expression vectors and host systems are optimal for producing recombinant DDB_G0277665?

Expression SystemAdvantagesConsiderations for DDB_G0277665
E. coliFast growth, high yield, simple handlingMay not provide proper post-translational modifications for a eukaryotic membrane protein
Insect cellsEukaryotic PTMs, better for membrane proteinsMore complex, longer production time
Yeast systemsEukaryotic PTMs, lower cost than mammalianMay have different membrane composition than D. discoideum
D. discoideum itselfNative environment, proper PTMsLower yields, more specialized techniques required

The methodology should be adjusted based on research needs: if functional studies are primary, expression in systems that maintain proper folding and modifications may be preferred, while structural studies might prioritize high yield. For membrane proteins like DDB_G0277665, detergent screening is essential during purification to maintain native conformation.

How can DDB_G0277665 be studied in the context of D. discoideum's chemotaxis pathways?

D. discoideum cells demonstrate amoeboid movement similar to human leukocytes, migrating toward chemical cues like folic acid or cAMP . To investigate whether DDB_G0277665 plays a role in chemotaxis:

  • Generate DDB_G0277665 knockout mutants using CRISPR-Cas9 or homologous recombination, exploiting D. discoideum's haploid genome for easier genetic manipulation

  • Compare chemotactic responses of wild-type and knockout cells using under-agarose folate chemotaxis assays or cAMP-directed developmental aggregation assays

  • Employ fluorescent protein tagging to track DDB_G0277665 localization during chemotactic movement

  • Analyze potential interactions with known chemotaxis proteins like TORC2 complex components, RAS, PTEN, PI3K, PKB, or PAKa

This approach harnesses D. discoideum's well-established chemotaxis model system, which has previously revealed conserved components also functioning in human immune cell movement. If DDB_G0277665 influences chemotaxis, the findings could be relevant to understanding human immune cell migration or cancer cell metastasis.

What techniques can resolve contradictory data about DDB_G0277665 subcellular localization?

When facing contradictory data about the subcellular localization of transmembrane proteins like DDB_G0277665, a multi-technique approach is essential:

  • Fluorescent protein fusion: Create N- and C-terminal GFP fusions to determine if tag position affects localization

  • Immunofluorescence with antibodies against the endogenous protein

  • Subcellular fractionation followed by Western blotting

  • Proximity labeling techniques like BioID or APEX to identify neighboring proteins

  • Co-localization studies with established organelle markers

D. discoideum cellular compartments can be visualized similarly to mammalian cells, though with some distinct features. For example, the γ-secretase complex components in D. discoideum localize to the endoplasmic reticulum similar to mammalian models . Contradictory localization data might result from dynamic protein trafficking, developmental stage differences, or technical artifacts. A time-course analysis during D. discoideum's developmental cycle could reveal stage-specific localization patterns.

How can researchers investigate potential roles of DDB_G0277665 in D. discoideum development and differentiation?

D. discoideum undergoes a unique developmental cycle with both unicellular and multicellular stages , providing an excellent system to study protein function in development:

  • Create DDB_G0277665 knockout and overexpression strains

  • Analyze developmental timing and morphology on non-nutrient agar

  • Assess cell-type specific differentiation using markers for prestalk and prespore cells

  • Perform RNA-seq at different developmental timepoints to measure transcriptional consequences

  • Use rescue experiments with mutated versions to identify functional domains

The developmental phenotype approach has previously proven valuable for presenilin protein studies in D. discoideum, where disruption of both presenilin proteins caused a clear developmental block . If DDB_G0277665 shows developmental phenotypes, researchers should test if human homologs (if identified) can rescue the phenotype, as demonstrated with human presenilin proteins in D. discoideum presenilin mutants .

What are the optimal protocols for generating and validating DDB_G0277665 knockout mutants in D. discoideum?

Creating knockout mutants in D. discoideum offers advantages due to its haploid genome. A comprehensive methodology includes:

  • Design construct for homologous recombination or CRISPR-Cas9 targeting

    • For homologous recombination: ~500-1000bp homology arms flanking a selection marker

    • For CRISPR-Cas9: sgRNAs targeting early exons plus repair template

  • Transformation protocols:

    • Electroporation (most common): 0.4cm cuvette, 0.65kV, 25μF, 2 pulses

    • Calcium phosphate precipitation for larger constructs

  • Selection and clonal isolation:

    • Appropriate antibiotic selection (G418, blasticidin, hygromycin)

    • Dilution cloning on bacterial lawns

  • Validation strategies:

    • PCR verification of integration site

    • RT-PCR and Western blot to confirm absence of transcript and protein

    • Phenotypic rescue with reintroduced gene to confirm specificity

  • Control considerations:

    • Use parental strain alongside knockout in all experiments

    • Consider creating a "rescue" strain expressing the wild-type gene

    • For transmembrane proteins, verify membrane integrity is not generally compromised

Similar genetic approaches have been successful in studying presenilin proteins in D. discoideum, allowing identification of non-proteolytic functions in development .

What analytical techniques are most effective for identifying interaction partners of DDB_G0277665?

For identifying protein-protein interactions of DDB_G0277665, consider these methodological approaches:

TechniqueAdvantagesLimitations for DDB_G0277665
Co-immunoprecipitationDirect physical interaction, can detect endogenous interactionsRequires specific antibodies, may disrupt weak interactions
Proximity labeling (BioID, APEX)Captures transient interactions, works in native environmentMay label nearby non-interacting proteins
Yeast two-hybridHigh-throughput screeningMembrane proteins often problematic, high false positive rate
Split-GFP complementationVisualizes interactions in living cellsRequires protein engineering, may affect function
Mass spectrometry after crosslinkingCaptures weak/transient interactionsComplex data analysis

For transmembrane proteins like DDB_G0277665, proximity labeling approaches are particularly valuable as they can identify neighboring proteins without disrupting membrane environments. When interpreting interaction data, researchers should consider that the D. discoideum proteome has significant orthology to human proteins , potentially allowing identification of conserved interaction networks.

How can researchers effectively distinguish between direct and indirect phenotypic effects when studying DDB_G0277665 function?

Distinguishing direct from indirect effects requires rigorous experimental design:

  • Create precise genetic tools:

    • Point mutations rather than complete knockouts

    • Conditional expression systems

    • Domain-specific mutations

  • Employ temporal control strategies:

    • Inducible expression/repression systems

    • Acute inhibition (if inhibitors available)

    • Time-course analyses with fine resolution

  • Implement comprehensive rescue strategies:

    • Domain-specific rescue experiments

    • Rescue with homologs from other species

    • Rescue with synthetic proteins containing specific functional domains

  • Utilize epistasis analysis:

    • Generate double mutants with known pathway components

    • Analyze hierarchical relationships between phenotypes

  • Perform immediate-early response studies:

    • Examine changes occurring immediately after perturbation

    • Distinguish primary responses from secondary adaptations

This approach has been successfully applied in D. discoideum presenilin studies, where researchers determined that catalytic aspartic acid residues were not required for developmental functions, distinguishing between proteolytic and non-proteolytic roles .

How conserved is DDB_G0277665 across species, and what does this suggest about its functional importance?

Investigating evolutionary conservation of DDB_G0277665 requires:

  • Comprehensive homology searches using:

    • Position-Specific Iterative BLAST (PSI-BLAST)

    • Hidden Markov Models (HMMs)

    • Structural prediction-based searches

  • Comparative analysis parameters:

    • Sequence identity/similarity percentages

    • Domain conservation vs. whole-protein conservation

    • Transmembrane topology conservation

    • Presence/absence patterns across evolutionary clades

  • Interpretation framework:

    • Highly conserved regions likely indicate functional importance

    • Rapidly evolving regions may suggest adaptive pressure

    • Conservation patterns across specific lineages may indicate specialized functions

Could DDB_G0277665 be relevant to understanding human disease mechanisms, based on D. discoideum's established disease models?

D. discoideum has proven valuable for studying multiple human disease mechanisms . To assess DDB_G0277665's potential relevance:

  • Identify human diseases associated with transmembrane protein dysfunction

  • Determine if DDB_G0277665 shares sequence/structural similarity with disease-associated human proteins

  • Investigate if DDB_G0277665 participates in conserved pathways implicated in human disease

  • Assess if DDB_G0277665 knockout phenotypes mimic cellular pathologies seen in disease models

D. discoideum has successfully modeled aspects of neurological disorders despite lacking neurons, through the study of conserved cellular processes . For example, human proteins like α-synuclein and Tau have been expressed in D. discoideum to study mechanisms of cellular toxicity . Even without direct homology, DDB_G0277665 might participate in fundamental cellular processes relevant to disease, particularly if it functions in membrane organization, trafficking, or signaling.

How can researchers utilize DDB_G0277665 to advance the broader field of transmembrane protein biology?

Transmembrane proteins present unique challenges in research. DDB_G0277665 in D. discoideum offers methodological advantages:

  • Expression system benefits:

    • D. discoideum grows rapidly compared to mammalian cells

    • Functions in both unicellular and multicellular contexts

    • Has a haploid genome facilitating genetic manipulation

    • Can be grown in large quantities for biochemical studies

  • Functional characterization approaches:

    • Study in native membrane environment

    • Analyze in developmentally regulated processes

    • Investigate in well-characterized signaling pathways like chemotaxis

  • Translational research strategies:

    • Use as a platform to express and study human transmembrane proteins

    • Develop screening assays for modulators of transmembrane protein function

    • Model membrane protein trafficking and quality control

D. discoideum provides an intermediate level of complexity between unicellular yeasts and multicellular animals , offering a balance between experimental tractability and biological relevance. Discoveries about transmembrane protein biology in this system could inform approaches to studying more complex systems, particularly for proteins involved in conserved cellular processes like chemotaxis, phagocytosis, or cell-cell communication.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.