Recombinant Dictyostelium discoideum Putative UDP-sugar transporter DDB_G0278631 (DDB_G0278631)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please specify them in your order remarks. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
DDB_G0278631; Putative UDP-sugar transporter DDB_G0278631
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-382
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0278631
Target Protein Sequence
MKLKPNDIYIPLNSIQFKIHHNDINIKYDTEEDNNNNNNNNNNNRYIDDNEKMKISEDES IFKSINNDNKNQQNDNIINSFNRGSNSFLFNIINFYKSPRFLSGGAVLLYVMTTYDFSAS NFLLFNQMVVTIVILHILKHFNILKINTNFEKETIKKLMPLSFCYIINVLLGLDSLKQLN IPMYSALKRLVAVVILVMEYFILKKVSPPKIIASVVVMVIGAVVAGITDLSFNSLGYSLV LLSCIFQASYLIYVKKVASNMSTYDMLYYNSVLSLPITIFLMIVNQEIEYFQTFEHLYDS SFQAYFILSIFLGFFLNFCIFFCTSVNSPLTTSVTGQVKNIASTIIGAMVFNDIIIHPIN ILGLIINIIGSIWYSFLKLTSK
Uniprot No.

Target Background

Function
May be involved in the import of UDP-sugars.
Database Links
Protein Families
TPT transporter family, SLC35D subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What expression systems are recommended for recombinant production of DDB_G0278631?

For recombinant production of DDB_G0278631, E. coli expression systems have been successfully employed. The recommended methodology involves:

  • Cloning the full-length coding sequence (1-382 amino acids) into an appropriate expression vector

  • Transformation into a suitable E. coli strain optimized for membrane protein expression

  • Induction under controlled conditions (typically IPTG-inducible systems)

  • Purification using affinity chromatography, often with a His-tag fusion

Expression ParameterRecommended Condition
Expression HostE. coli
Vector TypepET or similar with IPTG-inducible promoter
Fusion TagHis-tag (N or C-terminal)
Expression Temperature16-20°C (to minimize inclusion body formation)
Induction Duration16-20 hours
Cell Lysis MethodSonication or French press

When working with membrane proteins like DDB_G0278631, inclusion of detergents during purification is often necessary to maintain protein solubility and structural integrity .

What are the optimal storage conditions for preserving DDB_G0278631 functionality?

To maintain the structural integrity and functionality of recombinant DDB_G0278631, the following storage conditions are recommended:

  • Primary storage: -20°C for short-term or -80°C for extended storage

  • Storage buffer: Tris-based buffer with 50% glycerol (optimized specifically for this protein)

  • Working aliquots can be stored at 4°C for up to one week

  • Repeated freeze-thaw cycles should be avoided as they can compromise protein activity

For experimental work involving transport activity assays, it's advisable to prepare small aliquots during initial storage to minimize freeze-thaw cycles. The addition of protease inhibitors may further enhance stability during extended storage periods.

What methods are available for detecting and quantifying DDB_G0278631 in experimental samples?

Several methodological approaches can be employed for detecting and quantifying DDB_G0278631:

  • Western Blot Analysis:

    • Using anti-His antibodies if working with His-tagged recombinant protein

    • Using custom antibodies raised against DDB_G0278631-specific peptides

  • Mass Spectrometry:

    • LC-MS/MS analysis of tryptic digests

    • Selected Reaction Monitoring (SRM) for targeted quantification

  • Fluorescence Microscopy:

    • GFP fusion constructs for cellular localization studies

    • Immunofluorescence using specific antibodies

  • Functional Assays:

    • Transport activity measurements using radiolabeled UDP-sugars

    • Reconstitution in liposomes to assess transport function

When quantifying expression levels, researchers should consider using appropriate housekeeping genes or proteins as internal controls to normalize expression data across different experimental conditions .

How does DDB_G0278631 function within the UDP-sugar transport pathway in Dictyostelium discoideum?

DDB_G0278631 likely functions as a specialized transporter in the secretory pathway of Dictyostelium discoideum, facilitating the movement of UDP-sugars across cellular membranes. Based on research involving similar transporters in Dictyostelium, we can understand its role in the broader context of glycosylation pathways:

  • UDP-sugars synthesized in the cytosol need to be transported into the lumen of the secretory pathway (Golgi and ER) for glycosylation reactions.

  • DDB_G0278631 appears to be involved in this transport process, potentially with specificity for certain UDP-sugar subtypes.

  • Studies on GDP-Fuc transporters in Dictyostelium provide a model for understanding nucleotide sugar transport mechanisms that may apply to DDB_G0278631 .

Research on the GDP-Fuc transporter (DDB_G0277007) showed that mutations affecting transmembrane helices and the sugar recognition motif resulted in loss of transport activity. By analogy, the function of DDB_G0278631 likely depends on similar structural features essential for substrate recognition and transport .

The following diagram represents the hypothesized pathway:

CompartmentProcessProteins Involved
CytosolUDP-sugar synthesisUDP-sugar pyrophosphorylases
MembraneUDP-sugar transportDDB_G0278631 and similar transporters
LumenGlycosylation reactionsVarious glycosyltransferases

Investigating DDB_G0278631 function requires a comprehensive experimental approach combining genetic manipulation and biochemical characterization of transport activity .

What experimental designs are most effective for studying the function of DDB_G0278631 in vivo?

To effectively study DDB_G0278631 function in vivo, researchers should consider a multi-faceted experimental design approach:

  • Gene Disruption Studies:

    • CRISPR-Cas9 mediated knockout of DDB_G0278631

    • Analysis of phenotypic consequences during growth and development

    • Complementation studies with wild-type and mutant forms

  • Localization Studies:

    • Fluorescent protein tagging (GFP/RFP) to determine subcellular localization

    • Co-localization with known organelle markers

    • Live-cell imaging during different developmental stages

  • Transport Activity Assays:

    • Isolation of relevant cellular compartments

    • Measurement of UDP-sugar transport using radiolabeled substrates

    • Comparison of transport kinetics between wild-type and mutant cells

  • Glycomic Profiling:

    • Mass spectrometry analysis of glycan structures in wild-type vs. knockout cells

    • Identification of specific glycosylation defects resulting from DDB_G0278631 deficiency

When designing these experiments, it's crucial to include appropriate controls and to consider potential compensatory mechanisms by other transporters. The goal should be to allow unbiased evaluation of the consequences of altering DDB_G0278631 function, regardless of how other factors are set .

Based on similar studies with UDP-glucose pyrophosphorylase mutants in Dictyostelium, which showed developmental defects due to insufficient UDP-glucose levels, researchers should pay particular attention to developmental phenotypes when analyzing DDB_G0278631 mutants .

How should researchers address contradictory data when studying DDB_G0278631 function?

When encountering contradictory data in DDB_G0278631 research, a systematic approach is recommended:

  • Thoroughly Examine the Data:

    • Identify specific discrepancies between expected results and actual findings

    • Analyze outliers that may have influenced the results

    • Compare data with existing literature on similar transporters

  • Evaluate Initial Assumptions and Research Design:

    • Reassess the hypothesized function of DDB_G0278631

    • Review experimental conditions and controls

    • Consider whether the chosen methods adequately measure the intended parameters

  • Consider Alternative Explanations:

    • Functional redundancy with other transporters

    • Context-dependent protein function

    • Post-translational modifications affecting activity

    • Indirect effects on cellular metabolism

  • Refine Experimental Approach:

    • Modify data collection methods

    • Implement additional controls

    • Use complementary techniques to validate findings

Contradictory results should not be dismissed but rather viewed as opportunities for deeper understanding. Publishing contradictory findings is important for advancing scientific knowledge, as emphasized in research literature .

As demonstrated in studies of other nucleotide sugar transporters, contradictions often lead to the discovery of more complex regulatory mechanisms or previously unknown functions .

What analytical approaches can be used to study the structure-function relationship of DDB_G0278631?

Investigating the structure-function relationship of DDB_G0278631 requires a combination of computational and experimental approaches:

  • Sequence-Based Analysis:

    • Multiple sequence alignment with characterized UDP-sugar transporters

    • Identification of conserved motifs and critical residues

    • Prediction of transmembrane domains and topology

  • Molecular Modeling:

    • Homology modeling based on crystal structures of related transporters

    • Molecular dynamics simulations to predict substrate interactions

    • In silico mutagenesis to identify critical residues

  • Site-Directed Mutagenesis:

    • Systematic mutation of conserved residues identified through sequence analysis

    • Creation of chimeric proteins with related transporters

    • Domain swapping experiments to identify functional regions

  • Functional Characterization:

    • Transport assays with purified protein reconstituted in liposomes

    • Substrate specificity determination using various UDP-sugars

    • Kinetic analysis to determine transport parameters

Drawing from studies on barley UDP-glucose pyrophosphorylase, research on structure-function relationships should focus on identifying domains essential for structural integrity, catalytic properties, and substrate binding .

Domain/MotifPredicted FunctionExperimental Approach
Transmembrane helicesForming transport channelAlanine scanning mutagenesis
Conserved charged residuesSubstrate recognitionPoint mutations and transport assays
N-terminal regionProtein-protein interactionsTruncation analysis
C-terminal regionRegulation of activityDeletion analysis

These approaches will help elucidate how the structural features of DDB_G0278631 contribute to its specific function in UDP-sugar transport .

How can researchers effectively design experiments to determine the specificity of DDB_G0278631 for different UDP-sugar substrates?

To determine the substrate specificity of DDB_G0278631, researchers should design experiments that directly measure transport activity with different UDP-sugar substrates:

  • Preparation of Transport-Competent Protein:

    • Purify recombinant DDB_G0278631 with minimal detergent

    • Reconstitute into liposomes or proteoliposomes

    • Verify correct orientation in membrane

  • Direct Transport Assays:

    • Prepare vesicles containing purified DDB_G0278631

    • Incubate with various radiolabeled UDP-sugars (UDP-glucose, UDP-galactose, UDP-N-acetylglucosamine, etc.)

    • Measure uptake over time using filtration or centrifugation techniques

    • Calculate transport kinetics (Km, Vmax) for each substrate

  • Competition Assays:

    • Measure transport of a preferred substrate in the presence of unlabeled competing substrates

    • Determine IC50 values for each competing substrate

    • Establish a hierarchy of substrate preferences

  • Analysis in Cellular Context:

    • Express DDB_G0278631 in a heterologous system lacking endogenous UDP-sugar transporters

    • Measure changes in cellular glycosylation patterns

    • Analyze rescue of glycosylation defects with different UDP-sugars

For proper experimental design, researchers should include appropriate controls such as non-functional mutants and vesicles without reconstituted protein. Statistical analysis should be rigorous, with at least 10 replicates per experimental condition to ensure reliable results .

Based on studies of UDP-glucose pyrophosphorylase in Dictyostelium, which showed enzyme specificity affecting development, the substrate specificity of DDB_G0278631 likely has significant implications for cellular function .

What is the current understanding of how DDB_G0278631 interacts with other proteins in the nucleotide sugar metabolism pathway?

The current understanding of DDB_G0278631's protein interaction network remains limited, but several methodological approaches can be used to elucidate these interactions:

  • Protein-Protein Interaction Analyses:

    • Yeast two-hybrid screening to identify binding partners

    • Co-immunoprecipitation followed by mass spectrometry

    • Proximity labeling techniques (BioID, APEX) to identify proteins in close proximity

  • Functional Relationships:

    • Genetic interaction screens (synthetic lethality/sickness)

    • Suppressor screens to identify genes that compensate for DDB_G0278631 deficiency

    • Comparative phenotypic analysis of relevant mutants

Based on studies of related proteins in Dictyostelium, DDB_G0278631 likely interacts with:

  • UDP-sugar synthesizing enzymes (e.g., UDP-glucose pyrophosphorylase)

  • Glycosyltransferases that utilize UDP-sugars

  • Regulatory proteins that control transporter activity

Studies on UDP-glucose metabolism in Dictyostelium discoideum have revealed that UDP-glucose pyrophosphorylase (UGPase) is regulated by cell-cell contact and exogenous cyclic AMP (cAMP). Given the functional relationship between UDP-sugar synthesis and transport, similar regulatory mechanisms might apply to DDB_G0278631 .

In the broader context of nucleotide sugar metabolism, research has shown that pyrophosphate (PPi) can inhibit gluconeogenesis by restricting UDP-glucose formation through effects on UDP-glucose pyrophosphorylase. This highlights the interconnected nature of these metabolic pathways and suggests that DDB_G0278631 function may be influenced by cellular energy status and PPi levels .

To comprehensively map the protein interaction network of DDB_G0278631, researchers should employ a combination of these methods and validate key interactions through multiple independent approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.