Recombinant Dictyostelium discoideum Putative uncharacterized protein DDB_G0274369 (DDB_G0274369)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Dictyostelium discoideum Putative uncharacterized protein DDB_G0274369 is a protein that, as its name suggests, has not yet been fully characterized . It is found in the slime mold Dictyostelium discoideum, an organism increasingly recognized for its unique proteomic features and resilience to protein aggregation .

Table 1: General Information

FeatureDescription
NameRecombinant Full Length Dictyostelium discoideum Putative Uncharacterized Protein DDB_G0274369(DDB_G0274369)
OrganismDictyostelium discoideum
SynonymsDDB_G0274369; Putative uncharacterized protein DDB_G0274369
UniProt IDQ86IV0
SourceE. coli
TagHis-Tagged
Protein LengthFull Length (1-352 amino acids)
PurityGreater than 90% as determined by SDS-PAGE

Gene and Protein Information

The DDB_G0274369 protein is encoded by the gene DDB_G0274369 in Dictyostelium discoideum . The recombinant form of this protein consists of 352 amino acids . The amino acid sequence for this protein is :

MGLKIVDGSIVHDNLTSSSPPSVTNSSPLLNTKRRNSITSLSDYKKNKDTLNNSNNNINQPFENSNNFNNNSKEIKNENKIKNFFQHLFSILLLKNPTMIQIIETLELSTNIYNIQFKLKYLLAICVSSQIIFKSSGLLITLLVLYLGTFFNKISINNKDKNKNNNTIDYSLKNNNIDTSLIKDINNSVISNNSSNSNNNNINNSNNNNNNNNRILSPNQLSKSSNVEYNKCKCKSPTTSSNNYLSSSQSRVQTLSSPNISPCNICVSPNLLYNSLSSLSSSLPINSCNYSMSEQEGDE FESNFDFEDSQYEESDEEDNSSPAFHLYSSPNLRVACNKISTFSPNGRKLGTN

Expression and Purification

Recombinant DDB_G0274369 protein is typically produced in E. coli and purified using His-tag affinity chromatography . The His-tag is fused to the N-terminal of the protein to facilitate purification .

Table 2: Recombinant Protein Details

FeatureDescription
HostE. coli
TagN-terminal His tag
FormLyophilized powder
ReconstitutionReconstitute in deionized sterile water to 0.1-1.0 mg/mL
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
StorageStore at -20°C/-80°C upon receipt; avoid repeated freeze-thaw cycles

Potential Functions and Pathways

Table 3: Predicted Functions and Pathways

CategoryDescriptionRelated Proteins
Pathway(Specific pathways are not listed in the search results)(Proteins involved in the same pathways are not listed)
Biochemical Functions(Specific functions are not listed in the search results)(Proteins with the same functions are not listed)
Interacting ProteinsInteracts with other proteins and molecules(Specific interacting proteins are not listed)

Significance in Research

Dictyostelium discoideum is notable for its unique prion-like proteome and its ability to handle aggregation-prone proteins . DDB_G0274369, as a putative uncharacterized protein in this organism, may offer insights into the mechanisms of protein homeostasis and aggregation . Investigating this protein could contribute to understanding similar processes in other organisms, including humans .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
DDB_G0274369; Putative uncharacterized protein DDB_G0274369
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-352
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0274369
Target Protein Sequence
MGLKIVDGSIVHDNLTSSSPPSVTNSSPLLNTKRRNSITSLSDYKKNKDTLNNSNNNINQ PFENSNNFNNNSKEIKNENKIKNFFQHLFSILLLKNPTMIQIIETLELSTNIYNIQFKLK YLLAICVSSQIIFKSSGLLITLLVLYLGTFFNKISINNKDKNKNNNTIDYSLKNNNIDTS LIKDINNSVISNNSSNSNNNNINNSNNNNNNNNRILSPNQLSKSSNVEYNKCKCKSPTTS SNNYLSSSQSRVQTLSSPNISPCNICVSPNLLYNSLSSLSSSLPINSCNYSMSEQEGDEF ESNFDFEDSQYEESDEEDNSSPAFHLYSSPNLRVACNKISTFSPNGRKLGTN
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

Why is studying uncharacterized proteins like DDB_G0274369 in Dictyostelium discoideum valuable for research?

Investigating uncharacterized proteins like DDB_G0274369 in D. discoideum offers several significant advantages for fundamental biological research:

Model Organism Benefits: D. discoideum serves as an inexpensive and high-throughput model system for studying cellular and developmental processes including cell movement, chemotaxis, differentiation, and autophagy . Its unique life cycle comprising both unicellular and multicellular phases makes it particularly valuable for developmental studies .

Translational Relevance: Many cellular pathways in D. discoideum are conserved in higher eukaryotes, making findings potentially applicable to human health and disease. Research has shown that D. discoideum can serve as a non-mammalian model for human diseases, particularly those related to cell motility and neurodegeneration .

Functional Discovery: Uncharacterized proteins often represent knowledge gaps in our understanding of cellular systems. Characterizing DDB_G0274369 may reveal novel functions or regulatory mechanisms in important cellular processes such as:

  • Host-pathogen interactions, as D. discoideum serves as a model for phagocytosis

  • Genome stability mechanisms, as DNA repair pathways are conserved in this organism

  • Neurodegenerative disease models, as human disease gene orthologs can be functionally tested in this organism

Proteome Completion: Identifying the function of uncharacterized proteins contributes to completing the functional annotation of the D. discoideum proteome, enhancing our understanding of this model organism and potentially revealing new research tools .

What expression and purification strategies are recommended for recombinant DDB_G0274369?

Based on protocols used for similar Dictyostelium proteins, the following expression and purification strategy is recommended:

Expression System Design:

  • Construct: Full-length DDB_G0274369 (352 amino acids) with N-terminal His-tag

  • Expression vector: pET series vectors (pET28a recommended) for IPTG-inducible expression

  • Host: E. coli BL21(DE3) or Rosetta(DE3) strains for optimal expression of eukaryotic proteins

  • Consider including a protease cleavage site between the tag and protein for tag removal if needed

Expression Protocol:

  • Transform expression plasmid into E. coli cells and select transformants

  • Grow culture to OD600 of 0.6-0.8 at 37°C

  • Induce with 0.1-0.5 mM IPTG

  • Continue expression at 16-18°C for 16-18 hours (lower temperature improves solubility)

  • Harvest cells by centrifugation (4,000 × g, 20 minutes, 4°C)

Purification Procedure:

  • Ni-NTA Affinity Chromatography:

    • Lyse cells in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, protease inhibitors

    • Bind to Ni-NTA resin

    • Wash with increasing imidazole concentrations

    • Elute with 250 mM imidazole

  • Size Exclusion Chromatography:

    • Further purify using Superdex 75/200 column

    • Elute with 20 mM Tris-HCl pH 8.0, 150 mM NaCl

Quality Control:

  • Verify purity by SDS-PAGE (aim for >90% purity)

  • Confirm identity by western blot and/or mass spectrometry

  • Assess protein stability through thermal shift assays

Similar recombinant proteins from D. discoideum typically show the following properties:

PropertyTypical Value for DDB_G Proteins
Expression SystemE. coli
Purity>85-90% (SDS-PAGE)
Storage-20°C/-80°C
BufferTris/PBS with stabilizers
Yield5-10 mg/L culture

This approach has been successful for related proteins such as DDB_G0274369, DDB_G0291786, and DDB_G0287265 .

What experimental approaches can be used to characterize the function of DDB_G0274369?

To elucidate the function of DDB_G0274369, a multi-faceted experimental strategy is recommended:

Gene Disruption Studies:

  • Generate a DDB_G0274369 null mutant using homologous recombination or CRISPR-Cas9

  • Analyze resulting phenotypes across development, chemotaxis, phagocytosis, and growth

  • Compare to wild-type cells under various conditions, including nutrient stress

  • Perform transcriptomic and proteomic analyses to identify compensatory changes

Protein Localization:

  • Create fluorescently tagged versions of DDB_G0274369 (e.g., GFP fusion)

  • Determine subcellular localization using confocal microscopy

  • Monitor localization changes during development or in response to stimuli like cAMP

  • Perform co-localization studies with known organelle markers

Protein-Protein Interactions:

  • Conduct immunoprecipitation followed by mass spectrometry

  • Perform proximity labeling approaches (BioID, APEX)

  • Map protein interaction networks to infer function from known interaction partners

  • Special consideration should be given to potential interactions with components of chemotaxis pathways

Developmental and Functional Assays:

  • Assess the protein's role in chemotactic responses to cAMP and folate

  • Examine development on non-nutrient agar over 24 hours

  • Quantify aggregation, slug formation, and fruiting body development

  • Test the ability of mutant cells to participate in chimeric development with wild-type cells

Domain-Specific Analysis:

  • Generate truncation or point mutants affecting specific regions

  • Test complementation of knockout phenotypes with mutant constructs

  • Identify essential residues or domains for protein function

Biochemical Characterization:

  • Perform activity assays based on predicted functions

  • Analyze post-translational modifications

  • Determine binding partners through in vitro binding assays

The combination of these approaches has proven effective for characterizing previously uncharacterized proteins in Dictyostelium .

What computational approaches can predict the structure and function of DDB_G0274369?

Multiple bioinformatic approaches can generate testable hypotheses about DDB_G0274369 function:

Structural Modeling:

  • Tools like AlphaFold2 or I-TASSER can predict 3D structures by homology modeling

  • These predictions may suggest activities such as hydrolase or transferase functions, as observed in similar D. discoideum proteins like DDB_G0275279

  • Molecular dynamics simulations can evaluate structural stability and identify potential binding sites

Domain Analysis:

  • Search for conserved domains using PFAM, SMART, or InterPro

  • Examine for signal peptides using SignalP to determine if the protein is secreted

  • Investigate the presence of domains like DUF3430, which has been associated with bacteriolytic roles in homologous D. discoideum proteins

Sequence-Based Comparative Analysis:

  • BLAST searches against characterized proteins to identify functional homologs

  • Multiple sequence alignment with related proteins to identify conserved residues

  • Phylogenetic analysis to place DDB_G0274369 in evolutionary context with proteins of known function

Network-Based Function Prediction:

  • Construct protein-protein interaction networks incorporating known D. discoideum protein interactions

  • Apply guilt-by-association algorithms to predict functions based on network neighbors

  • Integrate interactome data with differential expression data from various developmental stages

Expression Pattern Analysis:

  • Analyze when and where DDB_G0274369 is expressed during the D. discoideum life cycle

  • Correlate expression patterns with developmental stages or responses to environmental stimuli

  • Co-expression network analysis to identify functionally related genes

How does proteomic analysis of DDB_G0274369 compare to transcriptomic data in Dictyostelium development?

Integrating proteomic and transcriptomic data provides crucial insights into DDB_G0274369's role in Dictyostelium development:

Correlation Between Transcript and Protein Levels:

cAMP Signaling Context:

  • Early developmental events in D. discoideum are regulated by cAMP pulses

  • Proteomic iTRAQ analysis shows quantitative differences in protein expression patterns when cells are pulsed with cAMP

  • During development in shaken suspension, many genes show differential expression when treated with cAMP pulses at 6-minute intervals

  • Analysis should examine whether DDB_G0274369 is among the differentially regulated proteins in developed cells compared to vegetative wild-type cells

Methodological Considerations:

  • Transcriptomic approaches typically offer higher sensitivity for detecting low-abundance transcripts

  • Proteomic approaches directly measure protein abundance and can detect post-translational modifications

  • For a complete picture, both approaches should be combined with examination of protein localization and interaction partners

Developmental Context:

  • The slime mold D. discoideum transitions from solitary amoebae to multicellular structures during development

  • This transition involves complex chemotactic processes mediated by cAMP signaling

  • Memory mechanisms allow cells to maintain directional movement even when chemical gradients change

  • Correlating DDB_G0274369 expression with specific developmental stages can provide functional insights

Such integrated analysis positions DDB_G0274369 within the developmental program of Dictyostelium and generates testable hypotheses about its function .

How might DDB_G0274369 relate to chemotaxis and cAMP signaling in Dictyostelium?

Several lines of evidence suggest potential roles for DDB_G0274369 in chemotaxis and cAMP signaling:

cAMP Signaling Context:

  • Cyclic AMP acts as a critical secondary messenger in D. discoideum, regulating development, chemotaxis, and multicellular aggregation

  • During starvation, D. discoideum cells release cAMP pulses, creating gradients that guide cell aggregation

  • Proteomic analyses have identified numerous proteins whose expression levels change in response to cAMP pulsing

Potential Functional Roles:

  • DDB_G0274369 might function in chemotactic signal transduction pathways, potentially downstream of cAMP receptor activation

  • It could be involved in cytoskeletal reorganization necessary for directed cell movement

  • The protein might participate in the establishment of cellular memory during chemotaxis, allowing cells to maintain directional movement even when gradients change

Structural Features of Interest:

  • The amino acid sequence of DDB_G0274369 contains multiple serine and threonine residues that could serve as phosphorylation sites for PKA or other kinases activated in the cAMP pathway

  • The presence of repeated asparagine residues in the sequence suggests potential roles in protein-protein interactions common in signaling cascades

Connection to GSK-3 Signaling:

  • Research has shown that GlkA, a GSK-3 family protein kinase, regulates growth, chemotaxis, and multicellular development

  • Proteomic comparison between wild-type and glkA-null cells reveals proteins whose levels depend on GlkA activity

  • This connection might place DDB_G0274369 in a specific branch of the chemotaxis signaling network

Experimental Approaches to Test Function:

  • Assess chemotaxis of DDB_G0274369 knockout cells toward cAMP in under-agar or micropipette assays

  • Measure cAMP-induced calcium flux in cells lacking DDB_G0274369

  • Examine the phosphorylation state of DDB_G0274369 before and after cAMP stimulation

  • Analyze the development of DDB_G0274369 mutants in chimeras with wild-type cells

What are the challenges in studying uncharacterized proteins like DDB_G0274369 and how can they be overcome?

Studying uncharacterized proteins like DDB_G0274369 presents several challenges requiring strategic approaches:

Functional Prediction Challenges:

  • Limited Sequence Homology: DDB_G0274369 may have few recognizable homologs with known functions
    Solution: Use sensitive sequence analysis tools (PSI-BLAST, HHpred) and structural prediction (AlphaFold2) to detect remote relationships

  • Multifunctional Potential: The protein may serve different functions in different contexts
    Solution: Study the protein across multiple conditions and developmental stages; perform domain-specific analysis

  • Redundancy: Functional redundancy with other proteins may mask phenotypes
    Solution: Generate multiple knockout combinations; perform synthetic lethality screens

Technical Challenges:

  • Protein Expression: Recombinant expression may result in insoluble or misfolded protein
    Solution: Optimize expression conditions (temperature, host strain, fusion tags); consider insect or mammalian expression systems

  • Antibody Generation: Generating specific antibodies can be difficult for proteins with low immunogenicity
    Solution: Use epitope tagging; consider nanobody development; use mass spectrometry for detection

  • Post-translational Modifications: Important modifications may be missing in recombinant systems
    Solution: Compare protein expressed in D. discoideum with bacterial systems; identify modification sites by mass spectrometry

Phenotypic Analysis Challenges:

  • Subtle Phenotypes: Knockout effects may be condition-specific or subtle
    Solution: Test multiple stress conditions; use high-content imaging; perform quantitative analysis of multiple parameters

  • Developmental Complexity: Effects may manifest only at specific developmental stages
    Solution: Conduct detailed time-course analysis throughout the D. discoideum life cycle

Strategic Approaches:

  • Begin with subcellular localization studies to provide initial functional clues

  • Use comparative proteomics across developmental stages and conditions

  • Employ systems biology approaches to place the protein in interaction networks

  • Develop conditional expression systems for temporal control of protein function

  • Combine in vivo studies with in vitro biochemical characterization

By addressing these challenges systematically, researchers can overcome the difficulties in studying uncharacterized proteins like DDB_G0274369 and make meaningful contributions to understanding its function.

How can DDB_G0274369 research contribute to understanding fundamental cellular processes?

Research on DDB_G0274369 has potential to advance our understanding of several key cellular processes:

Chemotaxis and Cell Migration:

  • D. discoideum serves as a premier model for studying eukaryotic chemotaxis

  • Understanding the role of DDB_G0274369 in directed cell movement could reveal conserved mechanisms relevant to immune cell migration, cancer metastasis, and wound healing

  • The memory mechanisms that allow cells to maintain directional movement involve molecular pathways that may be conserved across species

Signal Transduction:

  • The cAMP signaling pathway in Dictyostelium shares components with mammalian systems

  • Characterizing DDB_G0274369's potential role in this pathway could identify novel regulatory mechanisms

  • Combined proteomic and transcriptomic approaches have successfully identified components of these signaling networks

Developmental Regulation:

  • The transition from unicellular to multicellular states in D. discoideum involves precise coordination of gene expression

  • If DDB_G0274369 participates in this process, it may reveal insights into developmental timing and pattern formation

  • The complex regulation of development in response to environmental cues (like starvation) involves numerous uncharacterized proteins

Host-Pathogen Interactions:

  • D. discoideum serves as a model for studying phagocytosis and bacterial virulence

  • If DDB_G0274369 functions in these processes, it could reveal mechanisms relevant to innate immunity

  • Proteins with DUF3430 domains in Dictyostelium have been associated with bacteriolytic activities

Protein Function Discovery Paradigm:

  • The systematic characterization of DDB_G0274369 demonstrates methodologies applicable to studying other uncharacterized proteins

  • Integrating computational predictions with experimental validation creates a framework for functional genomics

  • Such approaches help close the gap between genome sequencing and functional annotation

By investigating DDB_G0274369 through multiple experimental approaches, researchers can contribute not only to understanding this specific protein but also to broader knowledge of fundamental cellular processes.

How can knockout and localization studies of DDB_G0274369 be designed for maximum insight?

Designing effective knockout and localization studies requires careful planning:

Knockout Strategy Design:

  • Gene Targeting Approach:

    • Design a construct with a selectable marker flanked by homologous regions of DDB_G0274369

    • Aim for homology arms of ~1-1.5 kb each for efficient recombination

    • Consider CRISPR-Cas9 as an alternative approach targeting early exons

  • Controls and Validation:

    • Generate multiple independent knockout clones to rule out off-target effects

    • Validate knockouts through genomic PCR, RT-PCR, and Western blotting

    • Create rescue strains expressing wild-type DDB_G0274369 to confirm phenotype specificity

  • Phenotypic Analysis Framework:

    • Examine growth in axenic medium and on bacterial lawns

    • Assess development on non-nutrient agar with time-lapse imaging

    • Quantify chemotaxis toward folate (vegetative cells) and cAMP (developed cells)

    • Evaluate phagocytosis, macropinocytosis, and cytoskeletal organization

    • Test stress responses including osmotic stress and oxidative stress

Localization Study Design:

  • Fusion Protein Construction:

    • Create both N- and C-terminal fluorescent protein fusions (GFP, mCherry)

    • Include a flexible linker between DDB_G0274369 and the tag

    • Use the endogenous promoter to maintain native expression levels

    • As a control, create point mutations in key predicted functional domains

  • Expression Systems:

    • Express tagged proteins in both wild-type and DDB_G0274369-null backgrounds

    • Ensure that tagged proteins rescue knockout phenotypes

    • Use inducible promoters for temporal control of expression

  • Imaging Approaches:

    • Perform live cell imaging during growth, development, and chemotaxis

    • Use confocal microscopy to determine precise subcellular localization

    • Conduct co-localization studies with markers for organelles and cytoskeletal elements

    • Employ super-resolution microscopy for detailed structural analysis

    • Perform FRAP (Fluorescence Recovery After Photobleaching) to assess protein dynamics

  • Condition-Dependent Localization:

    • Monitor localization changes during development

    • Assess changes in response to cAMP stimulation

    • Observe effects of cytoskeletal disrupting agents

    • Examine localization during phagocytosis and macropinocytosis

Integrative Analysis:

  • Correlate localization patterns with knockout phenotypes

  • Identify interaction partners at specific subcellular locations

  • Combine with biochemical characterization of domains/motifs

  • Create computational models of protein dynamics based on imaging data

This comprehensive approach to knockout and localization studies will provide maximum insight into the function of DDB_G0274369 in cellular processes and development .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.