Recombinant Dictyostelium discoideum Putative uncharacterized protein DDB_G0274369 is a protein that, as its name suggests, has not yet been fully characterized . It is found in the slime mold Dictyostelium discoideum, an organism increasingly recognized for its unique proteomic features and resilience to protein aggregation .
| Feature | Description |
|---|---|
| Name | Recombinant Full Length Dictyostelium discoideum Putative Uncharacterized Protein DDB_G0274369(DDB_G0274369) |
| Organism | Dictyostelium discoideum |
| Synonyms | DDB_G0274369; Putative uncharacterized protein DDB_G0274369 |
| UniProt ID | Q86IV0 |
| Source | E. coli |
| Tag | His-Tagged |
| Protein Length | Full Length (1-352 amino acids) |
| Purity | Greater than 90% as determined by SDS-PAGE |
The DDB_G0274369 protein is encoded by the gene DDB_G0274369 in Dictyostelium discoideum . The recombinant form of this protein consists of 352 amino acids . The amino acid sequence for this protein is :
MGLKIVDGSIVHDNLTSSSPPSVTNSSPLLNTKRRNSITSLSDYKKNKDTLNNSNNNINQPFENSNNFNNNSKEIKNENKIKNFFQHLFSILLLKNPTMIQIIETLELSTNIYNIQFKLKYLLAICVSSQIIFKSSGLLITLLVLYLGTFFNKISINNKDKNKNNNTIDYSLKNNNIDTSLIKDINNSVISNNSSNSNNNNINNSNNNNNNNNRILSPNQLSKSSNVEYNKCKCKSPTTSSNNYLSSSQSRVQTLSSPNISPCNICVSPNLLYNSLSSLSSSLPINSCNYSMSEQEGDE FESNFDFEDSQYEESDEEDNSSPAFHLYSSPNLRVACNKISTFSPNGRKLGTN
Recombinant DDB_G0274369 protein is typically produced in E. coli and purified using His-tag affinity chromatography . The His-tag is fused to the N-terminal of the protein to facilitate purification .
| Feature | Description |
|---|---|
| Host | E. coli |
| Tag | N-terminal His tag |
| Form | Lyophilized powder |
| Reconstitution | Reconstitute in deionized sterile water to 0.1-1.0 mg/mL |
| Storage Buffer | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Storage | Store at -20°C/-80°C upon receipt; avoid repeated freeze-thaw cycles |
| Category | Description | Related Proteins |
|---|---|---|
| Pathway | (Specific pathways are not listed in the search results) | (Proteins involved in the same pathways are not listed) |
| Biochemical Functions | (Specific functions are not listed in the search results) | (Proteins with the same functions are not listed) |
| Interacting Proteins | Interacts with other proteins and molecules | (Specific interacting proteins are not listed) |
Dictyostelium discoideum is notable for its unique prion-like proteome and its ability to handle aggregation-prone proteins . DDB_G0274369, as a putative uncharacterized protein in this organism, may offer insights into the mechanisms of protein homeostasis and aggregation . Investigating this protein could contribute to understanding similar processes in other organisms, including humans .
KEGG: ddi:DDB_G0274369
Investigating uncharacterized proteins like DDB_G0274369 in D. discoideum offers several significant advantages for fundamental biological research:
Model Organism Benefits: D. discoideum serves as an inexpensive and high-throughput model system for studying cellular and developmental processes including cell movement, chemotaxis, differentiation, and autophagy . Its unique life cycle comprising both unicellular and multicellular phases makes it particularly valuable for developmental studies .
Translational Relevance: Many cellular pathways in D. discoideum are conserved in higher eukaryotes, making findings potentially applicable to human health and disease. Research has shown that D. discoideum can serve as a non-mammalian model for human diseases, particularly those related to cell motility and neurodegeneration .
Functional Discovery: Uncharacterized proteins often represent knowledge gaps in our understanding of cellular systems. Characterizing DDB_G0274369 may reveal novel functions or regulatory mechanisms in important cellular processes such as:
Host-pathogen interactions, as D. discoideum serves as a model for phagocytosis
Genome stability mechanisms, as DNA repair pathways are conserved in this organism
Neurodegenerative disease models, as human disease gene orthologs can be functionally tested in this organism
Proteome Completion: Identifying the function of uncharacterized proteins contributes to completing the functional annotation of the D. discoideum proteome, enhancing our understanding of this model organism and potentially revealing new research tools .
Based on protocols used for similar Dictyostelium proteins, the following expression and purification strategy is recommended:
Expression System Design:
Construct: Full-length DDB_G0274369 (352 amino acids) with N-terminal His-tag
Expression vector: pET series vectors (pET28a recommended) for IPTG-inducible expression
Host: E. coli BL21(DE3) or Rosetta(DE3) strains for optimal expression of eukaryotic proteins
Consider including a protease cleavage site between the tag and protein for tag removal if needed
Expression Protocol:
Transform expression plasmid into E. coli cells and select transformants
Grow culture to OD600 of 0.6-0.8 at 37°C
Induce with 0.1-0.5 mM IPTG
Continue expression at 16-18°C for 16-18 hours (lower temperature improves solubility)
Harvest cells by centrifugation (4,000 × g, 20 minutes, 4°C)
Purification Procedure:
Ni-NTA Affinity Chromatography:
Lyse cells in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, protease inhibitors
Bind to Ni-NTA resin
Wash with increasing imidazole concentrations
Elute with 250 mM imidazole
Size Exclusion Chromatography:
Further purify using Superdex 75/200 column
Elute with 20 mM Tris-HCl pH 8.0, 150 mM NaCl
Quality Control:
Verify purity by SDS-PAGE (aim for >90% purity)
Confirm identity by western blot and/or mass spectrometry
Assess protein stability through thermal shift assays
Similar recombinant proteins from D. discoideum typically show the following properties:
| Property | Typical Value for DDB_G Proteins |
|---|---|
| Expression System | E. coli |
| Purity | >85-90% (SDS-PAGE) |
| Storage | -20°C/-80°C |
| Buffer | Tris/PBS with stabilizers |
| Yield | 5-10 mg/L culture |
This approach has been successful for related proteins such as DDB_G0274369, DDB_G0291786, and DDB_G0287265 .
To elucidate the function of DDB_G0274369, a multi-faceted experimental strategy is recommended:
Gene Disruption Studies:
Generate a DDB_G0274369 null mutant using homologous recombination or CRISPR-Cas9
Analyze resulting phenotypes across development, chemotaxis, phagocytosis, and growth
Compare to wild-type cells under various conditions, including nutrient stress
Perform transcriptomic and proteomic analyses to identify compensatory changes
Protein Localization:
Create fluorescently tagged versions of DDB_G0274369 (e.g., GFP fusion)
Determine subcellular localization using confocal microscopy
Monitor localization changes during development or in response to stimuli like cAMP
Perform co-localization studies with known organelle markers
Protein-Protein Interactions:
Conduct immunoprecipitation followed by mass spectrometry
Perform proximity labeling approaches (BioID, APEX)
Map protein interaction networks to infer function from known interaction partners
Special consideration should be given to potential interactions with components of chemotaxis pathways
Developmental and Functional Assays:
Assess the protein's role in chemotactic responses to cAMP and folate
Examine development on non-nutrient agar over 24 hours
Quantify aggregation, slug formation, and fruiting body development
Test the ability of mutant cells to participate in chimeric development with wild-type cells
Domain-Specific Analysis:
Generate truncation or point mutants affecting specific regions
Test complementation of knockout phenotypes with mutant constructs
Identify essential residues or domains for protein function
Biochemical Characterization:
Perform activity assays based on predicted functions
Analyze post-translational modifications
Determine binding partners through in vitro binding assays
The combination of these approaches has proven effective for characterizing previously uncharacterized proteins in Dictyostelium .
Multiple bioinformatic approaches can generate testable hypotheses about DDB_G0274369 function:
Structural Modeling:
Tools like AlphaFold2 or I-TASSER can predict 3D structures by homology modeling
These predictions may suggest activities such as hydrolase or transferase functions, as observed in similar D. discoideum proteins like DDB_G0275279
Molecular dynamics simulations can evaluate structural stability and identify potential binding sites
Domain Analysis:
Search for conserved domains using PFAM, SMART, or InterPro
Examine for signal peptides using SignalP to determine if the protein is secreted
Investigate the presence of domains like DUF3430, which has been associated with bacteriolytic roles in homologous D. discoideum proteins
Sequence-Based Comparative Analysis:
BLAST searches against characterized proteins to identify functional homologs
Multiple sequence alignment with related proteins to identify conserved residues
Phylogenetic analysis to place DDB_G0274369 in evolutionary context with proteins of known function
Network-Based Function Prediction:
Construct protein-protein interaction networks incorporating known D. discoideum protein interactions
Apply guilt-by-association algorithms to predict functions based on network neighbors
Integrate interactome data with differential expression data from various developmental stages
Expression Pattern Analysis:
Analyze when and where DDB_G0274369 is expressed during the D. discoideum life cycle
Correlate expression patterns with developmental stages or responses to environmental stimuli
Co-expression network analysis to identify functionally related genes
Integrating proteomic and transcriptomic data provides crucial insights into DDB_G0274369's role in Dictyostelium development:
Correlation Between Transcript and Protein Levels:
cAMP Signaling Context:
Early developmental events in D. discoideum are regulated by cAMP pulses
Proteomic iTRAQ analysis shows quantitative differences in protein expression patterns when cells are pulsed with cAMP
During development in shaken suspension, many genes show differential expression when treated with cAMP pulses at 6-minute intervals
Analysis should examine whether DDB_G0274369 is among the differentially regulated proteins in developed cells compared to vegetative wild-type cells
Methodological Considerations:
Transcriptomic approaches typically offer higher sensitivity for detecting low-abundance transcripts
Proteomic approaches directly measure protein abundance and can detect post-translational modifications
For a complete picture, both approaches should be combined with examination of protein localization and interaction partners
Developmental Context:
The slime mold D. discoideum transitions from solitary amoebae to multicellular structures during development
This transition involves complex chemotactic processes mediated by cAMP signaling
Memory mechanisms allow cells to maintain directional movement even when chemical gradients change
Correlating DDB_G0274369 expression with specific developmental stages can provide functional insights
Such integrated analysis positions DDB_G0274369 within the developmental program of Dictyostelium and generates testable hypotheses about its function .
Several lines of evidence suggest potential roles for DDB_G0274369 in chemotaxis and cAMP signaling:
cAMP Signaling Context:
Cyclic AMP acts as a critical secondary messenger in D. discoideum, regulating development, chemotaxis, and multicellular aggregation
During starvation, D. discoideum cells release cAMP pulses, creating gradients that guide cell aggregation
Proteomic analyses have identified numerous proteins whose expression levels change in response to cAMP pulsing
Potential Functional Roles:
DDB_G0274369 might function in chemotactic signal transduction pathways, potentially downstream of cAMP receptor activation
It could be involved in cytoskeletal reorganization necessary for directed cell movement
The protein might participate in the establishment of cellular memory during chemotaxis, allowing cells to maintain directional movement even when gradients change
Structural Features of Interest:
The amino acid sequence of DDB_G0274369 contains multiple serine and threonine residues that could serve as phosphorylation sites for PKA or other kinases activated in the cAMP pathway
The presence of repeated asparagine residues in the sequence suggests potential roles in protein-protein interactions common in signaling cascades
Connection to GSK-3 Signaling:
Research has shown that GlkA, a GSK-3 family protein kinase, regulates growth, chemotaxis, and multicellular development
Proteomic comparison between wild-type and glkA-null cells reveals proteins whose levels depend on GlkA activity
This connection might place DDB_G0274369 in a specific branch of the chemotaxis signaling network
Experimental Approaches to Test Function:
Assess chemotaxis of DDB_G0274369 knockout cells toward cAMP in under-agar or micropipette assays
Measure cAMP-induced calcium flux in cells lacking DDB_G0274369
Examine the phosphorylation state of DDB_G0274369 before and after cAMP stimulation
Analyze the development of DDB_G0274369 mutants in chimeras with wild-type cells
Studying uncharacterized proteins like DDB_G0274369 presents several challenges requiring strategic approaches:
Functional Prediction Challenges:
Limited Sequence Homology: DDB_G0274369 may have few recognizable homologs with known functions
Solution: Use sensitive sequence analysis tools (PSI-BLAST, HHpred) and structural prediction (AlphaFold2) to detect remote relationships
Multifunctional Potential: The protein may serve different functions in different contexts
Solution: Study the protein across multiple conditions and developmental stages; perform domain-specific analysis
Redundancy: Functional redundancy with other proteins may mask phenotypes
Solution: Generate multiple knockout combinations; perform synthetic lethality screens
Technical Challenges:
Protein Expression: Recombinant expression may result in insoluble or misfolded protein
Solution: Optimize expression conditions (temperature, host strain, fusion tags); consider insect or mammalian expression systems
Antibody Generation: Generating specific antibodies can be difficult for proteins with low immunogenicity
Solution: Use epitope tagging; consider nanobody development; use mass spectrometry for detection
Post-translational Modifications: Important modifications may be missing in recombinant systems
Solution: Compare protein expressed in D. discoideum with bacterial systems; identify modification sites by mass spectrometry
Phenotypic Analysis Challenges:
Subtle Phenotypes: Knockout effects may be condition-specific or subtle
Solution: Test multiple stress conditions; use high-content imaging; perform quantitative analysis of multiple parameters
Developmental Complexity: Effects may manifest only at specific developmental stages
Solution: Conduct detailed time-course analysis throughout the D. discoideum life cycle
Strategic Approaches:
Begin with subcellular localization studies to provide initial functional clues
Use comparative proteomics across developmental stages and conditions
Employ systems biology approaches to place the protein in interaction networks
Develop conditional expression systems for temporal control of protein function
Combine in vivo studies with in vitro biochemical characterization
By addressing these challenges systematically, researchers can overcome the difficulties in studying uncharacterized proteins like DDB_G0274369 and make meaningful contributions to understanding its function.
Research on DDB_G0274369 has potential to advance our understanding of several key cellular processes:
Chemotaxis and Cell Migration:
D. discoideum serves as a premier model for studying eukaryotic chemotaxis
Understanding the role of DDB_G0274369 in directed cell movement could reveal conserved mechanisms relevant to immune cell migration, cancer metastasis, and wound healing
The memory mechanisms that allow cells to maintain directional movement involve molecular pathways that may be conserved across species
Signal Transduction:
The cAMP signaling pathway in Dictyostelium shares components with mammalian systems
Characterizing DDB_G0274369's potential role in this pathway could identify novel regulatory mechanisms
Combined proteomic and transcriptomic approaches have successfully identified components of these signaling networks
Developmental Regulation:
The transition from unicellular to multicellular states in D. discoideum involves precise coordination of gene expression
If DDB_G0274369 participates in this process, it may reveal insights into developmental timing and pattern formation
The complex regulation of development in response to environmental cues (like starvation) involves numerous uncharacterized proteins
Host-Pathogen Interactions:
D. discoideum serves as a model for studying phagocytosis and bacterial virulence
If DDB_G0274369 functions in these processes, it could reveal mechanisms relevant to innate immunity
Proteins with DUF3430 domains in Dictyostelium have been associated with bacteriolytic activities
Protein Function Discovery Paradigm:
The systematic characterization of DDB_G0274369 demonstrates methodologies applicable to studying other uncharacterized proteins
Integrating computational predictions with experimental validation creates a framework for functional genomics
Such approaches help close the gap between genome sequencing and functional annotation
By investigating DDB_G0274369 through multiple experimental approaches, researchers can contribute not only to understanding this specific protein but also to broader knowledge of fundamental cellular processes.
Designing effective knockout and localization studies requires careful planning:
Knockout Strategy Design:
Gene Targeting Approach:
Design a construct with a selectable marker flanked by homologous regions of DDB_G0274369
Aim for homology arms of ~1-1.5 kb each for efficient recombination
Consider CRISPR-Cas9 as an alternative approach targeting early exons
Controls and Validation:
Generate multiple independent knockout clones to rule out off-target effects
Validate knockouts through genomic PCR, RT-PCR, and Western blotting
Create rescue strains expressing wild-type DDB_G0274369 to confirm phenotype specificity
Phenotypic Analysis Framework:
Examine growth in axenic medium and on bacterial lawns
Assess development on non-nutrient agar with time-lapse imaging
Quantify chemotaxis toward folate (vegetative cells) and cAMP (developed cells)
Evaluate phagocytosis, macropinocytosis, and cytoskeletal organization
Test stress responses including osmotic stress and oxidative stress
Localization Study Design:
Fusion Protein Construction:
Create both N- and C-terminal fluorescent protein fusions (GFP, mCherry)
Include a flexible linker between DDB_G0274369 and the tag
Use the endogenous promoter to maintain native expression levels
As a control, create point mutations in key predicted functional domains
Expression Systems:
Express tagged proteins in both wild-type and DDB_G0274369-null backgrounds
Ensure that tagged proteins rescue knockout phenotypes
Use inducible promoters for temporal control of expression
Imaging Approaches:
Perform live cell imaging during growth, development, and chemotaxis
Use confocal microscopy to determine precise subcellular localization
Conduct co-localization studies with markers for organelles and cytoskeletal elements
Employ super-resolution microscopy for detailed structural analysis
Perform FRAP (Fluorescence Recovery After Photobleaching) to assess protein dynamics
Condition-Dependent Localization:
Monitor localization changes during development
Assess changes in response to cAMP stimulation
Observe effects of cytoskeletal disrupting agents
Examine localization during phagocytosis and macropinocytosis
Integrative Analysis:
Correlate localization patterns with knockout phenotypes
Identify interaction partners at specific subcellular locations
Combine with biochemical characterization of domains/motifs
Create computational models of protein dynamics based on imaging data
This comprehensive approach to knockout and localization studies will provide maximum insight into the function of DDB_G0274369 in cellular processes and development .