Recombinant Dictyostelium discoideum Putative uncharacterized protein DDB_G0280391 (DDB_G0280391)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping is available upon request, but incurs additional charges. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
DDB_G0280391; Putative uncharacterized protein DDB_G0280391
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-141
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0280391
Target Protein Sequence
MNNNNNNNNNNNNNNNNNNNNNNNNNSYDSNHSSSSYTSENQNREQQFVFIPEEELERQS LLKKKDNLSYSINKDEIIIINNEDENDQNQTKDSTNPIVLRAKKVVDSFFCKIILVFICL VAIYSLVVIKCDGFHFNHCSP
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

How is recombinant DDB_G0280391 typically produced for research purposes?

Recombinant DDB_G0280391 is typically produced using E. coli expression systems, which allow for cost-effective protein production with reasonable yields . The commercially available versions of this protein are generally expressed as full-length constructs (amino acids 1-141) with an N-terminal 10xHis tag to facilitate purification . The recombinant protein is provided either in liquid form or as a lyophilized powder, typically in Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

The expression and purification process involves:

  • Cloning the DDB_G0280391 gene into an appropriate expression vector

  • Transformation of competent E. coli cells

  • Induction of protein expression

  • Cell lysis and extraction

  • Purification using affinity chromatography (taking advantage of the His-tag)

  • Quality control through SDS-PAGE and other analytical methods

For researchers working with this protein, it's important to note that storage conditions significantly impact stability, with recommendations to store at -20°C/-80°C and avoid repeated freeze-thaw cycles .

Why is Dictyostelium discoideum an important model organism for protein studies?

Dictyostelium discoideum has emerged as a valuable model organism for several key reasons, particularly in pathogenesis studies. This haploid social soil amoeba has been established as a host model for studying various pathogens including Pseudomonas aeruginosa, Cryptococcus neoformans, Mycobacterium species, and Legionella pneumophila .

The advantages of using Dictyostelium discoideum include:

  • Genetic tractability: As a haploid organism, it's relatively straightforward to generate and study mutants

  • Completed genome sequence: Facilitates genomic and proteomic studies

  • Available cell markers: Enables detailed subcellular localization studies

  • Well-characterized cell signaling pathways: Provides context for understanding protein function

  • Established host-pathogen interaction models: Allows studies of conserved mechanisms of pathogenesis

The completion of the Dictyostelium genome sequencing project has further enhanced its utility as a model system by providing researchers with comprehensive genomic information that facilitates identification and characterization of proteins like DDB_G0280391 . The organism's simple growth requirements and short life cycle also make it practical for laboratory studies compared to more complex eukaryotic models.

What experimental design approaches are optimal for improving soluble expression of DDB_G0280391?

The soluble expression of membrane proteins like DDB_G0280391 presents significant challenges. Based on experimental design approaches used for similar recombinant proteins, a multivariant statistical analysis is recommended over traditional univariant methods .

A factorial design approach should consider these key variables:

  • Expression temperature (typically testing 16°C, 25°C, and 37°C)

  • Induction time (early, mid, or late log phase)

  • Inducer concentration (IPTG concentration ranging from 0.1 to 1.0 mM)

  • Media composition (enriched vs. minimal media)

  • Presence of solubility enhancers (e.g., sorbitol, glycerol, or arginine)

This multivariant method allows researchers to:

  • Characterize experimental error

  • Compare the effects of different variables

  • Gather high-quality information with fewer experiments

  • Identify statistically significant variables and their interactions

For DDB_G0280391 specifically, researchers should consider that as a membrane protein, it may require specialized approaches such as:

  • Expression with fusion partners (MBP, SUMO, or thioredoxin)

  • Use of specialized E. coli strains (C41, C43, or Rosetta)

  • Addition of membrane-mimetic environments during purification

  • Co-expression with chaperones

By systematically varying these parameters and analyzing the results using statistical methods, researchers can optimize conditions to achieve higher yields of soluble, functional DDB_G0280391, potentially reaching levels comparable to the 250 mg/L achieved for other recombinant proteins using similar approaches .

How can researchers address potential contradictions in the literature when studying novel proteins like DDB_G0280391?

When studying novel proteins like DDB_G0280391, researchers may encounter apparently contradictory findings in the literature. To address these contradictions, a systematic approach based on context analysis is recommended .

Key strategies include:

  • Normalization of terminology: Ensure consistent naming conventions for the protein, including standardizing abbreviations and acronyms for DDB_G0280391 across studies .

  • Contextual analysis: Identify study-specific contexts that might explain different findings, including:

    • Experimental conditions (temperature, pH, buffer composition)

    • Expression systems used (E. coli strains, cell lines)

    • Protein constructs (full-length vs. truncated, tagged vs. untagged)

    • Analytical methods employed

  • Systematic literature review: Develop specific research questions (e.g., "What is the subcellular localization of DDB_G0280391?") and systematically evaluate evidence supporting different answers .

  • Structured annotation: When encountering potential contradictions, researchers should document:

    • The specific claim being made

    • The evidence supporting the claim

    • The experimental context

    • Any limitations acknowledged by the original authors

For DDB_G0280391 specifically, contradictions might arise regarding its function, localization, or interaction partners due to its currently uncharacterized nature. Researchers should be aware that high inter-annotator agreement (>90%) is possible when claims are properly normalized and contextualized , suggesting that apparent contradictions can often be resolved through careful analysis.

What purification strategies are most effective for recombinant DDB_G0280391?

Purifying membrane proteins like DDB_G0280391 requires specialized approaches. Based on the information available about this protein, an effective purification strategy would involve:

  • Affinity Chromatography (Primary purification):

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resins to capture the N-terminal 10xHis tag

    • Optimization of imidazole concentration in binding and elution buffers to minimize non-specific binding

    • Addition of mild detergents (0.1% DDM or 0.5% CHAPS) to maintain protein solubility

  • Secondary Purification:

    • Size exclusion chromatography (SEC) to separate monomeric protein from aggregates

    • Ion exchange chromatography to remove contaminants with different charge properties

  • Buffer Optimization:

    • Testing stability in various buffer systems (HEPES, Tris, phosphate)

    • Inclusion of stabilizing agents (glycerol, specific lipids, trehalose)

    • pH optimization (typically pH 7.0-8.0 for membrane proteins)

The final purification protocol should aim for at least 75% homogeneity while maintaining the functional state of the protein . For DDB_G0280391, it's particularly important to verify that the transmembrane domain remains properly folded after purification, which can be assessed using circular dichroism or fluorescence spectroscopy.

For long-term storage, the addition of 6% trehalose as a cryoprotectant has been found effective for this protein , and aliquoting to avoid repeated freeze-thaw cycles is recommended to maintain protein integrity.

How can researchers assess the functional activity of DDB_G0280391?

Assessing the functional activity of putative uncharacterized proteins like DDB_G0280391 presents a significant challenge. In the absence of known function, researchers can employ a systematic approach:

  • Structural Integrity Assessment:

    • Circular dichroism (CD) to verify secondary structure content

    • Thermal shift assays to determine protein stability

    • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to verify oligomeric state

  • Membrane Integration Analysis:

    • Fluorescence-based assays using environment-sensitive dyes

    • Proteoliposome reconstitution followed by flotation assays

    • Proteolytic accessibility assays to map topology

  • Functional Prediction & Testing:

    • Based on its transmembrane nature, potential functions might include:

      • Signal transduction

      • Transport

      • Cell adhesion

      • Pathogen interaction

    Testing these functions might involve:

    • Binding assays with potential ligands

    • Cellular localization during Dictyostelium infection with pathogens

    • Generation of knockout mutants and phenotypic characterization

    • Heterologous expression in mammalian cells followed by functional assays

  • Comparative Analysis:

    • Using Dictyostelium as a model organism for pathogenesis studies

    • Comparing phenotypes with other membrane protein knockouts

    • Testing for complementation of known mutant phenotypes

Given that Dictyostelium is established as a host model for studying interactions with pathogens like Pseudomonas aeruginosa and Legionella pneumophila , examining the role of DDB_G0280391 in these interactions could provide valuable functional insights.

What experimental approaches are recommended for studying the membrane topology of DDB_G0280391?

Understanding the membrane topology of DDB_G0280391 is crucial for elucidating its function. Based on its classification as a single-pass membrane protein , researchers should employ multiple complementary methods to verify and characterize its topology:

  • Computational Prediction:

    • Hydrophobicity analysis using algorithms like TMHMM or Phobius

    • Signal peptide prediction using SignalP

    • Topology prediction using TOPCONS or MEMSAT

  • Biochemical Approaches:

    • Cysteine scanning mutagenesis coupled with accessibility assays

    • Glycosylation mapping using engineered N-glycosylation sites

    • Protease protection assays on intact cells or microsomal preparations

  • Structural Biology Methods:

    • Cryo-electron microscopy of reconstituted protein

    • X-ray crystallography of protein domains (particularly soluble domains)

    • NMR spectroscopy of isolated domains

  • Fluorescence-Based Techniques:

    • Green Fluorescent Protein (GFP) fusion reporter assays

    • Fluorescence resonance energy transfer (FRET) between domains

    • Fluorescence quenching experiments with membrane-impermeable quenchers

A particularly effective approach would be to generate a series of truncation constructs of DDB_G0280391, each fused to a reporter protein like GFP. By analyzing the localization and accessibility of these constructs in cellular systems, researchers can map the orientation of different segments relative to the membrane.

The amino acid sequence provided (MNNNNNNNNNNNNNNNNNNNNNNNNNSYDSNHSSSSYTSENQNREQQFVFIPEEELERQSLLKKKDNLSYSINKDEIIIINNEDENDQNQTKDSTNPIVLRAKKVVDSFFCKIILVFICLVAIYSLVVIKCDGFHFNHCSP) should be analyzed for hydrophobic segments that might form transmembrane helices, as well as charged residues that typically flank transmembrane domains and help determine orientation.

How can researchers optimize experimental design when working with DDB_G0280391?

When designing experiments involving DDB_G0280391, researchers should implement principles of statistical experimental design to maximize information while minimizing resource use. The following approach is recommended based on successful strategies with similar proteins:

  • Factorial Design Implementation:

    • Use fractional factorial designs when investigating multiple variables

    • Ensure orthogonality in experimental design to allow independent parameter estimation

    • Consider response surface methodology for optimization of key conditions

  • Variable Selection:

    CategoryVariables to Consider
    ExpressionTemperature, inducer concentration, cell density at induction
    PurificationDetergent type, concentration, pH, salt concentration
    StorageBuffer composition, additive concentration, temperature
    Functional AssaysTime points, concentration ranges, control selection
  • Data Analysis Strategies:

    • Implement multivariate analysis to account for interactions between variables

    • Use statistical software to identify significant effects

    • Generate predictive models to guide further optimization

  • Sequential Optimization:

    • Begin with screening designs to identify important factors

    • Follow with optimization designs focusing on significant variables

    • Conduct validation experiments to confirm model predictions

This approach allows researchers to characterize experimental error systematically and compare the effects of variables when normalized, gathering high-quality information with minimal experiments . For DDB_G0280391 specifically, this methodology could help overcome challenges related to its membrane protein nature and uncharacterized function.

What considerations are important when studying DDB_G0280391 in the context of pathogenesis models?

Given that Dictyostelium discoideum serves as a host model for several pathogens, studying DDB_G0280391 in this context requires specific considerations:

  • Pathogen Selection:

    • Consider the established pathogen models for Dictyostelium, including:

      • Pseudomonas aeruginosa

      • Cryptococcus neoformans

      • Mycobacterium species

      • Legionella pneumophila

    • Select pathogens based on research questions about membrane protein involvement

  • Experimental Approaches:

    • Wild-type Dictyostelium as a screening system for pathogen virulence

    • DDB_G0280391 mutant cells to identify host determinants of susceptibility

    • Reporter systems to dissect host-pathogen cross-talk

  • Control Selection:

    • Include wild-type Dictyostelium strains as controls

    • Consider known membrane protein mutants as comparison groups

    • Include avirulent pathogen strains as controls

  • Analytical Considerations:

    • Monitor cellular localization of DDB_G0280391 during infection

    • Assess phenotypic changes in DDB_G0280391 mutants upon infection

    • Evaluate differences in pathogen uptake, survival, or replication

The tractability of Dictyostelium for genetic studies and the availability of host cell markers make it particularly valuable for studying the role of membrane proteins like DDB_G0280391 in pathogenesis . Researchers should leverage the completion of the genome sequencing project to design comprehensive experiments that examine potential functional roles of this protein in host-pathogen interactions.

What are promising approaches for determining the function of uncharacterized proteins like DDB_G0280391?

For determining the function of uncharacterized proteins like DDB_G0280391, researchers should consider integrated approaches that combine multiple lines of evidence:

  • Evolutionary Analysis:

    • Phylogenetic profiling to identify co-evolving proteins

    • Analysis of conservation patterns across species

    • Identification of conserved domains or motifs that might suggest function

  • Systems Biology Approaches:

    • Integration of proteomics, transcriptomics, and metabolomics data

    • Network analysis to identify functional clusters

    • Correlation analysis with proteins of known function

  • Advanced Genetic Techniques:

    • CRISPR-Cas9 mediated genome editing in Dictyostelium

    • Synthetic genetic array analysis to identify genetic interactions

    • Suppressor screening to identify compensatory mechanisms

  • High-throughput Phenotypic Screening:

    • Microscopy-based morphological profiling

    • Growth under various stress conditions

    • Response to different pathogens or environmental challenges

  • Structural Biology Integration:

    • Cryo-EM structure determination

    • Fragment-based ligand screening

    • Computational ligand docking and virtual screening

By combining these approaches, researchers can build multiple lines of evidence that converge on potential functions, even for challenging targets like uncharacterized membrane proteins. The integration of diverse data types is particularly valuable for proteins like DDB_G0280391, where single approaches might yield limited insights due to their novelty and unique characteristics.

How might contradictions in research findings about DDB_G0280391 be systematically addressed?

As research on DDB_G0280391 progresses, contradictory findings may emerge. To systematically address these contradictions, researchers should implement a structured framework:

  • Classification of Contradiction Types:

    • Direct contradictions (e.g., different subcellular localizations)

    • Partial contradictions (e.g., different binding partners in different contexts)

    • Contextual contradictions (similar findings interpreted differently)

  • Standardized Reporting Framework:

    • Document experimental conditions in detail

    • Report negative results alongside positive findings

    • Clearly distinguish between observations and interpretations

  • Meta-analysis Approach:

    • Apply statistical methods to evaluate strength of evidence

    • Weight findings based on methodology quality

    • Identify potential sources of heterogeneity across studies

  • Collaborative Resolution:

    • Establish multi-laboratory validation studies

    • Develop standard operating procedures for key assays

    • Implement open data sharing practices

When evaluating contradictory claims about DDB_G0280391, researchers should consider that high inter-annotator agreement (92-97%) is achievable when claims are properly normalized and contextually analyzed . This suggests that many apparent contradictions can be resolved through careful examination of experimental context and terminology standardization.

The framework should include specific yes/no questions about DDB_G0280391 (e.g., "Does DDB_G0280391 localize to the plasma membrane?") and systematically evaluate evidence supporting different answers, similar to approaches used in systematic reviews .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.