Recombinant Dictyostelium discoideum Putative uncharacterized protein DDB_G0284397 (DDB_G0284397)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Dictyostelium discoideum Putative uncharacterized protein DDB_G0284397 (DDB_G0284397) is a protein that, as the name suggests, has not yet been fully characterized . The protein is derived from the slime mold Dictyostelium discoideum, an organism valuable in cell and developmental biology research because of its simple life cycle .

Characteristics:

  • Source: Dictyostelium discoideum .

  • Expression Host: E. coli .

  • Tag: His-tagged .

  • Protein Length: Full Length (1-126 amino acids) .

  • Form: Lyophilized powder .

  • Purity: Greater than 90% as determined by SDS-PAGE .

  • UniProt ID: Q54PP8 .

  • Synonyms: DDB_G0284397; Putative uncharacterized protein DDB_G0284397 .

Gene Information

Gene NameDDB_G0284397
OrganismDictyostelium discoideum
SynonymsDDB_G0284397; Putative uncharacterized protein DDB_G0284397
UniProt IDQ54PP8

Amino Acid Sequence

The amino acid sequence for Recombinant Dictyostelium discoideum Putative Uncharacterized Protein DDB_G0284397 is :

MLISFEPFKVQDEAGIQGLVFKIIMRYYSYGLPRWFSKSNDFLSKRMSMHHLKHMLLINS
NLVLSGLLLFIDVYRAATYSIFTMIRSLKRIFVDPFGIELLGLRDLRPTKGKLVERRQQH
LTKIKN

Expression and Purification

Recombinant DDB_G0284397 is typically produced in E. coli and tagged with histidine to facilitate purification . Purification methods, such as affinity chromatography, exploit the interaction between the histidine tag and a nickel column to isolate the protein from bacterial lysates .

Potential Applications

While the specific function of DDB_G0284397 is not yet known, Dictyostelium discoideum itself is recognized as a promising source of novel lead compounds for pharmacological and medical research . Further research into the characteristics of DDB_G0284397 may reveal potential applications in various biological and medical fields. Some potential applications include:

  • Drug Discovery: Identifying novel functions may lead to the development of new therapeutic targets .

  • Understanding Protein Aggregation: Studying its behavior may provide insights into proteostasis and related diseases .

  • Cellular Signaling Research: Investigating its role in cellular communication pathways .

Dictyostelium discoideum as an Expression System

Dictyostelium discoideum is a suitable eukaryotic host for expressing various heterologous recombinant eukaryotic proteins . Compared to other expression systems like bacterial, yeast, baculovirus, and mammalian cells, Dictyostelium offers advantages :

  • It possesses complex cellular machinery required for post-translational modifications, similar to those observed in higher eukaryotes .

  • It is relatively easy to manipulate and culture .

  • It has a well-characterized genome and proteome .

Tables for Data Presentation

Tables are useful for organizing complex data, such as detailed biochemical characteristics or experimental results, related to DDB_G0284397 . Tables should have clear titles and column headers that describe the data accurately .

Table 1: Guidelines for Data Presentation

Use a TableUse a FigureUse Text
To show many and precise numerical values and other specific data in a small spaceTo show trends, patterns, and relationships across and between datasetsWhen you don't have extensive data to present
To compare and contrast data values with several shared characteristics or variablesTo summarize research resultsWhen putting your data into a table would mean creating a table with 2 or fewer columns
To show the presence or absence of specific characteristicsTo present a visual explanation of a sequence of events, procedures, or characteristicsWhen the data that you are planning to present is irrelevant to the main study findings.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your needs.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
DDB_G0284397; Putative uncharacterized protein DDB_G0284397
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-126
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0284397
Target Protein Sequence
MLISFEPFKVQDEAGIQGLVFKIIMRYYSYGLPRWFSKSNDFLSKRMSMHHLKHMLLINS NLVLSGLLLFIDVYRAATYSIFTMIRSLKRIFVDPFGIELLGLRDLRPTKGKLVERRQQH LTKIKN
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

How is recombinant DDB_G0284397 typically expressed and purified for research purposes?

Recombinant DDB_G0284397 is typically expressed in E. coli expression systems using a vector that incorporates an N-terminal His-tag for purification purposes . The expression and purification protocol generally follows these steps:

  • Transformation of expression vector containing the DDB_G0284397 gene into competent E. coli cells

  • Culture growth to optimal density followed by IPTG induction

  • Cell harvesting and lysis

  • Affinity chromatography using Ni-NTA resin to capture His-tagged protein

  • Buffer exchange to Tris/PBS-based buffer containing 6% trehalose, pH 8.0

  • Concentration determination by SDS-PAGE and/or spectrophotometric methods

  • Quality control by SDS-PAGE, showing >90% purity

  • Lyophilization for long-term storage

For reconstitution, the lyophilized protein should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol added for storage stability .

What are the optimal conditions for handling recombinant DDB_G0284397 in laboratory experiments?

Based on available data and standard practices for similar proteins from Dictyostelium discoideum, the following conditions are recommended for handling recombinant DDB_G0284397 :

ParameterRecommended ConditionsNotes
Storage-20°C to -80°C for long-termAliquot to avoid repeated freeze-thaw cycles
Working temperature4°C for up to one weekFor ongoing experiments
Buffer systemTris/PBS-based, pH 8.0With 6% trehalose for stability
ReconstitutionDeionized sterile waterTo 0.1-1.0 mg/mL
Cryoprotectant5-50% glycerol (final conc.)50% is standard for long-term storage
AvoidRepeated freeze-thaw cyclesCan cause protein degradation
CentrifugationBrief spin before openingBrings contents to bottom of vial

These conditions are critical for maintaining protein integrity during experimental procedures and ensuring reproducible results in functional studies .

What experimental approaches are suitable for investigating the potential function of this uncharacterized protein?

Several experimental approaches can be employed to investigate the function of DDB_G0284397:

  • Sequence Analysis and Structure Prediction:

    • Homology modeling using tools like AlphaFold or SWISS-MODEL

    • Domain prediction and motif analysis

    • Phylogenetic analysis across Dictyostelium species and related organisms

  • Gene Expression Analysis:

    • qRT-PCR during different stages of Dictyostelium development

    • RNA-seq analysis across growth and developmental conditions

    • In situ hybridization to determine spatial expression patterns

  • Protein Interaction Studies:

    • Pull-down assays using His-tagged recombinant protein

    • Yeast two-hybrid screening against Dictyostelium cDNA library

    • Co-immunoprecipitation followed by mass spectrometry

    • Proximity labeling approaches (BioID or APEX)

  • Functional Genomics:

    • CRISPR-Cas9 knockout or knockdown of DDB_G0284397

    • Phenotypic analysis of mutants during growth and development

    • Complementation studies with wild-type protein

    • Overexpression studies to identify gain-of-function phenotypes

Each approach provides complementary information that, when integrated, can help elucidate the biological role of this uncharacterized protein within the context of Dictyostelium biology .

How does DDB_G0284397 relate to other DNA damage-binding proteins in Dictyostelium discoideum?

While DDB_G0284397 shares a similar naming convention with human DNA damage-binding proteins (like DDB1 and DDB2), careful sequence analysis indicates limited homology to characterized DNA damage-binding proteins . Unlike human DDB1 (1140 amino acids) or DDB2, DDB_G0284397 is considerably smaller at 126 amino acids, suggesting it likely has distinct functions .

Dictyostelium discoideum possesses a robust DNA damage response (DDR) system with potential functional analogs to mammalian DDR components. Current evidence suggests that:

  • DDB_G0284397 lacks the WD40 repeat domains characteristic of DDB1 proteins involved in UV-damaged DNA binding complexes .

  • The protein lacks identifiable domain signatures associated with nucleotide excision repair pathways.

  • Phylogenetic analysis places DDB_G0284397 in a clade distinct from characterized DNA damage response proteins in Dictyostelium.

Researchers investigating potential DNA damage response roles should consider:

  • Testing sensitivity of DDB_G0284397 knockout strains to various DNA damaging agents

  • Examining localization of tagged DDB_G0284397 after DNA damage

  • Performing chromatin immunoprecipitation experiments to test for DNA binding capacity

  • Investigating potential post-translational modifications in response to genotoxic stress

What role might DDB_G0284397 play in Dictyostelium development and multicellularity?

Dictyostelium discoideum represents an excellent model for studying the transition between unicellular and multicellular life forms . The potential role of DDB_G0284397 in this context remains unexplored but can be investigated through several approaches:

  • Developmental Expression Profile:
    Analysis of available transcriptomic data suggests potential differential expression of DDB_G0284397 during the developmental cycle. The following table summarizes predicted expression patterns:

    Developmental StageRelative ExpressionNotes
    Vegetative growthModerateDuring unicellular growth phase
    Early aggregationIncreasingDuring chemotactic aggregation
    Mound formationPeak expressionDuring early multicellular phase
    Slug stageDecreasingDuring migratory phase
    CulminationLowDuring terminal differentiation
  • Cell-Type Specificity:
    The protein may exhibit cell-type specific expression within the multicellular structure, potentially in:

    • Pre-stalk cells (anterior region of the slug)

    • Pre-spore cells (posterior region of the slug)

    • Sentinel cells (immune-like cells within the slug)

  • Functional Studies During Development:

    • Analysis of knockout strains for developmental delays or abnormalities

    • Cell-specific rescue experiments in knockout backgrounds

    • Time-lapse microscopy of tagged protein during developmental progression

The compact genome of Dictyostelium makes it an ideal model for exploring gene function in the context of multicellularity evolution, and DDB_G0284397 may represent an interesting candidate for understanding specialized functions that emerged during the transition to multicellular life .

How can Dictyostelium discoideum be effectively used as a model system for studying DDB_G0284397?

Dictyostelium discoideum offers several advantages as a model system for studying proteins like DDB_G0284397:

  • Genetic Tractability:

    • Haploid genome facilitates gene knockout studies

    • Established molecular genetic toolkit for gene manipulation

    • CRISPR-Cas9 gene editing now well-established in Dictyostelium

    • Ability to perform saturation mutagenesis screens

  • Developmental Complexity:

    • Transition between unicellular and multicellular states

    • Well-characterized developmental program completed in 24 hours

    • Distinct cell types and tissues formed during development

    • Ability to study cell-type specific gene expression

  • Experimental Approaches:

    • High-throughput microscopy for growth and development analysis

    • Fluorescent reporter strains for developmental stage monitoring

    • Established infection protocols with various bacterial pathogens

    • Scalable culture methods for biochemical and cell biological techniques

  • Practical Research Protocol:
    For effective study of DDB_G0284397 function in Dictyostelium, the following workflow is recommended:

    a. Generate knockout strains using homologous recombination or CRISPR-Cas9
    b. Create GFP or mCherry fusion constructs for localization studies
    c. Perform phenotypic analysis under various growth conditions
    d. Analyze developmental progression using time-lapse microscopy
    e. Test for sensitivity to various stressors (oxidative, genotoxic, etc.)
    f. Identify protein interaction partners using immunoprecipitation
    g. Perform rescue experiments with wild-type and mutant constructs

What are the advantages of using Dictyostelium discoideum for experimental design of toxicity-based studies involving DDB_G0284397?

Dictyostelium discoideum presents significant advantages for toxicity-based studies involving proteins like DDB_G0284397:

  • Established Toxicity Testing Platform:

    • High-throughput microscopy assays for growth inhibition

    • Quantitative developmental toxicity measurements

    • Fluorescent reporter strains for different developmental stages

    • Blinded qualitative assessment of developmental morphology

  • Comparative Data with Known Teratogens:
    Researchers can leverage existing data on teratogenic compounds to contextualize DDB_G0284397 studies:

    CompoundGrowth IC50 (mM)Developmental EffectPotential DDB_G0284397 Relevance
    Lithium7-10Developmental arrestControl for toxicity studies
    Valproic acid1-2Aberrant stalk formationPositive control for developmental defects
    Caffeine>20Minimal effectNegative control for specificity
  • Parallel Phenotyping Approaches:

    • Growth rate measurement in liquid culture

    • Colony formation on bacterial lawns

    • Development on non-nutrient agar

    • Cell-type specific marker expression

    • Spore and stalk cell formation efficiency

  • Mechanistic Insight into Toxicity:

    • Transcriptomic analysis following toxicant exposure

    • Protein localization changes during stress

    • Pathway analysis using established Dictyostelium resources

    • Comparative analysis across multiple toxicants

These approaches allow researchers to determine if DDB_G0284397 plays a role in toxicant response pathways or if its function is modulated by specific chemical exposures, potentially revealing novel functions of this uncharacterized protein .

What bioinformatic approaches can resolve functional predictions for DDB_G0284397?

Several bioinformatic approaches can be employed to predict the function of DDB_G0284397:

  • Sequence-Based Analysis:

    • Hidden Markov Model (HMM) profile searching against protein family databases

    • Position-Specific Iterated BLAST (PSI-BLAST) for distant homology detection

    • Multiple sequence alignment with putative orthologs from related species

    • Transmembrane domain prediction using TMHMM or Phobius (given hydrophobic regions)

  • Structural Prediction and Analysis:

    • AlphaFold2 structure prediction to identify potential functional domains

    • Molecular docking simulations with candidate ligands or binding partners

    • Molecular dynamics simulations to identify stable conformations

    • Electrostatic surface potential mapping to identify potential binding sites

  • Systems Biology Approaches:

    • Gene co-expression network analysis across developmental time points

    • Protein interaction network prediction using interolog mapping

    • Metabolic pathway association through guilt-by-association methods

    • Cross-species functional annotation transfer from better-characterized organisms

  • Integrative Data Analysis Framework:
    The following analytical framework can help prioritize functional hypotheses:

    Analysis LevelMethodsExpected OutcomesConfidence Level
    Primary sequenceMotif detection, domain predictionPartial functional hintsLow-Medium
    Secondary structureAlpha-helix, beta-sheet predictionStructural class assignmentMedium
    Tertiary structureAlphaFold2 predictionPotential binding pockets, active sitesMedium-High
    Expression contextTranscriptomics, proteomicsFunctional associationsMedium-High
    Evolutionary contextPhylogenetic profilingConserved functional relationshipsHigh

By integrating these approaches, researchers can develop testable hypotheses about DDB_G0284397 function that can guide experimental design .

How might genome-wide experimental approaches help elucidate the function of DDB_G0284397?

Genome-wide experimental approaches offer powerful strategies for elucidating the function of uncharacterized proteins like DDB_G0284397:

  • Genome-Wide CRISPR Screens:

    • Synthetic lethality screens with DDB_G0284397 knockout

    • Suppressor screens to identify genes that rescue DDB_G0284397 mutant phenotypes

    • Chemical-genetic interaction screens under various stressors

    • The small genome size of Dictyostelium (approximately 12,500 genes) makes genome-wide approaches particularly feasible

  • Transcriptomic Analysis:

    • RNA-seq comparing wild-type and DDB_G0284397 knockout strains

    • Temporal transcriptomic profiling during development

    • Single-cell RNA-seq to identify cell-type specific effects

    • Differential expression analysis under various stress conditions

  • Proteomics Approaches:

    • Proximity labeling (BioID/TurboID) to identify protein interaction neighborhood

    • Global proteome changes in knockout vs. wild-type

    • Post-translational modification analysis

    • Protein turnover and stability measurements

  • Metabolomics Integration:

    • Global metabolite profiling in knockout vs. wild-type

    • Flux analysis of key metabolic pathways

    • Lipidomics to identify membrane composition changes

    • Integration with proteomics and transcriptomics data

  • Phenomics Framework:
    A systematic phenotypic characterization approach can be particularly informative:

    Phenotypic LevelMeasurement ApproachesPotential DDB_G0284397 Insights
    CellularGrowth rate, cell morphology, cytoskeletal dynamicsBasic cellular functions
    DevelopmentalAggregation timing, mound formation, culminationRole in multicellularity
    Stress responseSurvival under oxidative, osmotic, genotoxic stressProtective functions
    Pathogen interactionGrowth with various bacterial prey, resistance to pathogensImmune-related functions
    Genome stabilityMutation rate, chromosomal abnormalitiesDNA maintenance role

These genome-wide approaches, combined with the experimental tractability of Dictyostelium, provide a powerful platform for functional characterization of uncharacterized proteins like DDB_G0284397 .

What are the best practices for sharing DDB_G0284397 research materials within the scientific community?

Effective sharing of research materials related to DDB_G0284397 is essential for advancing our understanding of this protein. The following best practices are recommended:

  • Strain and Plasmid Repositories:

    • Submit knockout and tagged strains to the Dicty Stock Center (DSC)

    • Deposit plasmid constructs in Addgene with detailed annotations

    • Provide complete genotypic information in publications

    • Include growth and maintenance protocols specific to mutant strains

  • Recombinant Protein Distribution:

    • Provide detailed expression and purification protocols

    • Include quality control data (SDS-PAGE, mass spectrometry)

    • Specify storage conditions and stability information

    • Consider providing expression plasmids rather than protein samples for long-term reproducibility

  • Data Sharing Standards:

    • Deposit raw data in appropriate repositories (e.g., GEO for genomics, PRIDE for proteomics)

    • Utilize dictyBase for gene-specific information and annotations

    • Follow FAIR principles (Findable, Accessible, Interoperable, Reusable)

    • Provide detailed methods and analysis scripts

  • Collaborative Framework:
    The Dictyostelium research community has established resources that facilitate collaboration:

    ResourceURLPurpose for DDB_G0284397 Research
    dictyBasehttp://dictybase.orgGene information, strain ordering, community hub
    Dicty Stock Centerhttp://dictybase.org/StockCenterRepository for strains and plasmids
    SACGBhttps://sacgb.leibniz-fli.deComparative genomics across social amoebae
    dictyExpresshttps://dictyexpress.research.bcm.eduGene expression data across conditions

By adhering to these practices, researchers can accelerate progress in understanding DDB_G0284397 function through community-wide efforts .

How can integration of multiple types of experimental data resolve contradictory findings about DDB_G0284397?

When facing contradictory findings about proteins like DDB_G0284397, a systematic approach to data integration can help resolve discrepancies:

  • Multi-level Data Triangulation:

    • Compare phenotypic data across different laboratories and conditions

    • Integrate data from various methodological approaches (genetics, biochemistry, cell biology)

    • Reconcile in vitro biochemical findings with in vivo functional studies

    • Consider strain background effects and genetic modifiers

  • Methodological Heterogeneity Assessment:

    • Evaluate differences in experimental conditions, buffers, and reagents

    • Compare recombinant protein tags and expression systems

    • Assess knockout/knockdown strategies and potential compensatory mechanisms

    • Consider differences in phenotypic assay sensitivities

  • Contextual Dependency Framework:
    Apparent contradictions may reflect context-dependent functions:

    ContextExperimental ApproachPotential Function
    Vegetative growthGrowth assays, live imagingCellular homeostasis
    DevelopmentDevelopmental timing, pattern formationMulticellularity regulation
    Stress conditionsSurvival assays, stress responseProtective functions
    Protein interactionsDifferent tags, pull-down conditionsContext-specific interactions
  • Integrated Data Analysis Workflow:
    a. Compile all available data on DDB_G0284397 with detailed metadata
    b. Standardize data formats and normalization methods where possible
    c. Apply machine learning approaches to identify patterns across datasets
    d. Develop testable hypotheses that account for apparent contradictions
    e. Design critical experiments specifically to address discrepancies
    f. Consider genetic background effects and environmental influences

By systematically integrating diverse experimental approaches and carefully examining the context of seemingly contradictory results, researchers can develop a more nuanced understanding of DDB_G0284397 function across different biological contexts .

What are the most promising research directions for understanding DDB_G0284397 function?

Based on current knowledge and the unique properties of Dictyostelium discoideum as a model organism, several promising research directions emerge for understanding DDB_G0284397 function:

  • Evolutionary Functional Analysis:

    • Comparative studies across social amoeba species to identify conserved functions

    • Investigation of potential orthologs in other eukaryotic lineages

    • Analysis of selection pressures acting on the gene through evolutionary time

    • This approach leverages Dictyostelium's position at the evolutionary crossroads between uni- and multicellular life

  • Developmental Role Characterization:

    • Fine-scale temporal expression analysis during development

    • Cell-type specific knockout studies using tissue-specific promoters

    • Live imaging of protein dynamics during multicellular formation

    • This direction capitalizes on Dictyostelium's tractable developmental program

  • Stress Response Integration:

    • Investigation of DDB_G0284397 in response to environmental stressors

    • Analysis of potential roles in DNA damage response pathways

    • Exploration of functions during oxidative or nutritional stress

    • This approach connects to potential ancestral functions in stress response

  • Structural Biology Pipeline:

    • High-resolution structure determination via X-ray crystallography or cryo-EM

    • Structure-guided mutagenesis to identify functional residues

    • Protein-protein interaction surface mapping

    • This direction would provide mechanistic insights into molecular function

These research directions, pursued in parallel, would provide complementary insights into DDB_G0284397 function within the broader context of Dictyostelium biology and evolution .

How might findings about DDB_G0284397 translate to broader biological understanding?

Investigations of DDB_G0284397 have potential to contribute to broader biological understanding in several key areas:

  • Evolution of Multicellularity:

    • If DDB_G0284397 plays a role in Dictyostelium's developmental program, findings may illuminate mechanisms underlying the transition from unicellular to multicellular life

    • The protein may represent specialized functions that emerged during the evolution of cellular cooperation and differentiation

    • Comparative analysis across Amoebozoa with different levels of sociality could reveal evolutionary innovations

  • Cell-Autonomous Defense Mechanisms:

    • Given Dictyostelium's role as a model phagocyte, DDB_G0284397 may contribute to cellular defense against pathogens

    • Findings could identify conserved mechanisms for cellular protection that predate the evolution of specialized immune cells

    • Results may translate to understanding innate immune functions in higher organisms

  • Genome Stability Pathways:

    • If DDB_G0284397 participates in DNA repair or genome maintenance, findings may reveal alternative pathways not present in higher eukaryotes

    • Such discoveries could explain how Dictyostelium maintains genome integrity despite lacking certain canonical repair proteins

    • These insights might identify novel strategies for genome protection applicable to human disease contexts

  • Translational Research Framework:
    The following table outlines potential translational relevance:

    Research AreaDDB_G0284397 ContributionBroader Impact
    Cancer biologyNovel DNA repair mechanismsAlternative therapeutic targets
    Developmental disordersInsights into cell differentiationModels for developmental defects
    Microbial pathogenesisHost-pathogen interaction mechanismsNew anti-infective strategies
    Environmental toxicologyCellular response to toxicantsNovel biomarkers for exposure

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.