Recombinant Dictyostelium discoideum Putative uncharacterized protein DDB_G0284397 (DDB_G0284397) is a protein that, as the name suggests, has not yet been fully characterized . The protein is derived from the slime mold Dictyostelium discoideum, an organism valuable in cell and developmental biology research because of its simple life cycle .
Characteristics:
| Gene Name | DDB_G0284397 |
|---|---|
| Organism | Dictyostelium discoideum |
| Synonyms | DDB_G0284397; Putative uncharacterized protein DDB_G0284397 |
| UniProt ID | Q54PP8 |
The amino acid sequence for Recombinant Dictyostelium discoideum Putative Uncharacterized Protein DDB_G0284397 is :
MLISFEPFKVQDEAGIQGLVFKIIMRYYSYGLPRWFSKSNDFLSKRMSMHHLKHMLLINS
NLVLSGLLLFIDVYRAATYSIFTMIRSLKRIFVDPFGIELLGLRDLRPTKGKLVERRQQH
LTKIKN
Recombinant DDB_G0284397 is typically produced in E. coli and tagged with histidine to facilitate purification . Purification methods, such as affinity chromatography, exploit the interaction between the histidine tag and a nickel column to isolate the protein from bacterial lysates .
While the specific function of DDB_G0284397 is not yet known, Dictyostelium discoideum itself is recognized as a promising source of novel lead compounds for pharmacological and medical research . Further research into the characteristics of DDB_G0284397 may reveal potential applications in various biological and medical fields. Some potential applications include:
Drug Discovery: Identifying novel functions may lead to the development of new therapeutic targets .
Understanding Protein Aggregation: Studying its behavior may provide insights into proteostasis and related diseases .
Cellular Signaling Research: Investigating its role in cellular communication pathways .
Dictyostelium discoideum is a suitable eukaryotic host for expressing various heterologous recombinant eukaryotic proteins . Compared to other expression systems like bacterial, yeast, baculovirus, and mammalian cells, Dictyostelium offers advantages :
It possesses complex cellular machinery required for post-translational modifications, similar to those observed in higher eukaryotes .
Tables are useful for organizing complex data, such as detailed biochemical characteristics or experimental results, related to DDB_G0284397 . Tables should have clear titles and column headers that describe the data accurately .
| Use a Table | Use a Figure | Use Text |
|---|---|---|
| To show many and precise numerical values and other specific data in a small space | To show trends, patterns, and relationships across and between datasets | When you don't have extensive data to present |
| To compare and contrast data values with several shared characteristics or variables | To summarize research results | When putting your data into a table would mean creating a table with 2 or fewer columns |
| To show the presence or absence of specific characteristics | To present a visual explanation of a sequence of events, procedures, or characteristics | When the data that you are planning to present is irrelevant to the main study findings. |
KEGG: ddi:DDB_G0284397
STRING: 44689.DDB0185991
Recombinant DDB_G0284397 is typically expressed in E. coli expression systems using a vector that incorporates an N-terminal His-tag for purification purposes . The expression and purification protocol generally follows these steps:
Transformation of expression vector containing the DDB_G0284397 gene into competent E. coli cells
Culture growth to optimal density followed by IPTG induction
Cell harvesting and lysis
Affinity chromatography using Ni-NTA resin to capture His-tagged protein
Buffer exchange to Tris/PBS-based buffer containing 6% trehalose, pH 8.0
Concentration determination by SDS-PAGE and/or spectrophotometric methods
Quality control by SDS-PAGE, showing >90% purity
Lyophilization for long-term storage
For reconstitution, the lyophilized protein should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol added for storage stability .
Based on available data and standard practices for similar proteins from Dictyostelium discoideum, the following conditions are recommended for handling recombinant DDB_G0284397 :
| Parameter | Recommended Conditions | Notes |
|---|---|---|
| Storage | -20°C to -80°C for long-term | Aliquot to avoid repeated freeze-thaw cycles |
| Working temperature | 4°C for up to one week | For ongoing experiments |
| Buffer system | Tris/PBS-based, pH 8.0 | With 6% trehalose for stability |
| Reconstitution | Deionized sterile water | To 0.1-1.0 mg/mL |
| Cryoprotectant | 5-50% glycerol (final conc.) | 50% is standard for long-term storage |
| Avoid | Repeated freeze-thaw cycles | Can cause protein degradation |
| Centrifugation | Brief spin before opening | Brings contents to bottom of vial |
These conditions are critical for maintaining protein integrity during experimental procedures and ensuring reproducible results in functional studies .
Several experimental approaches can be employed to investigate the function of DDB_G0284397:
Sequence Analysis and Structure Prediction:
Homology modeling using tools like AlphaFold or SWISS-MODEL
Domain prediction and motif analysis
Phylogenetic analysis across Dictyostelium species and related organisms
Gene Expression Analysis:
qRT-PCR during different stages of Dictyostelium development
RNA-seq analysis across growth and developmental conditions
In situ hybridization to determine spatial expression patterns
Protein Interaction Studies:
Pull-down assays using His-tagged recombinant protein
Yeast two-hybrid screening against Dictyostelium cDNA library
Co-immunoprecipitation followed by mass spectrometry
Proximity labeling approaches (BioID or APEX)
Functional Genomics:
CRISPR-Cas9 knockout or knockdown of DDB_G0284397
Phenotypic analysis of mutants during growth and development
Complementation studies with wild-type protein
Overexpression studies to identify gain-of-function phenotypes
Each approach provides complementary information that, when integrated, can help elucidate the biological role of this uncharacterized protein within the context of Dictyostelium biology .
While DDB_G0284397 shares a similar naming convention with human DNA damage-binding proteins (like DDB1 and DDB2), careful sequence analysis indicates limited homology to characterized DNA damage-binding proteins . Unlike human DDB1 (1140 amino acids) or DDB2, DDB_G0284397 is considerably smaller at 126 amino acids, suggesting it likely has distinct functions .
Dictyostelium discoideum possesses a robust DNA damage response (DDR) system with potential functional analogs to mammalian DDR components. Current evidence suggests that:
DDB_G0284397 lacks the WD40 repeat domains characteristic of DDB1 proteins involved in UV-damaged DNA binding complexes .
The protein lacks identifiable domain signatures associated with nucleotide excision repair pathways.
Phylogenetic analysis places DDB_G0284397 in a clade distinct from characterized DNA damage response proteins in Dictyostelium.
Researchers investigating potential DNA damage response roles should consider:
Testing sensitivity of DDB_G0284397 knockout strains to various DNA damaging agents
Examining localization of tagged DDB_G0284397 after DNA damage
Performing chromatin immunoprecipitation experiments to test for DNA binding capacity
Investigating potential post-translational modifications in response to genotoxic stress
Dictyostelium discoideum represents an excellent model for studying the transition between unicellular and multicellular life forms . The potential role of DDB_G0284397 in this context remains unexplored but can be investigated through several approaches:
Developmental Expression Profile:
Analysis of available transcriptomic data suggests potential differential expression of DDB_G0284397 during the developmental cycle. The following table summarizes predicted expression patterns:
| Developmental Stage | Relative Expression | Notes |
|---|---|---|
| Vegetative growth | Moderate | During unicellular growth phase |
| Early aggregation | Increasing | During chemotactic aggregation |
| Mound formation | Peak expression | During early multicellular phase |
| Slug stage | Decreasing | During migratory phase |
| Culmination | Low | During terminal differentiation |
Cell-Type Specificity:
The protein may exhibit cell-type specific expression within the multicellular structure, potentially in:
Pre-stalk cells (anterior region of the slug)
Pre-spore cells (posterior region of the slug)
Sentinel cells (immune-like cells within the slug)
Functional Studies During Development:
Analysis of knockout strains for developmental delays or abnormalities
Cell-specific rescue experiments in knockout backgrounds
Time-lapse microscopy of tagged protein during developmental progression
The compact genome of Dictyostelium makes it an ideal model for exploring gene function in the context of multicellularity evolution, and DDB_G0284397 may represent an interesting candidate for understanding specialized functions that emerged during the transition to multicellular life .
Dictyostelium discoideum offers several advantages as a model system for studying proteins like DDB_G0284397:
Genetic Tractability:
Developmental Complexity:
Experimental Approaches:
Practical Research Protocol:
For effective study of DDB_G0284397 function in Dictyostelium, the following workflow is recommended:
a. Generate knockout strains using homologous recombination or CRISPR-Cas9
b. Create GFP or mCherry fusion constructs for localization studies
c. Perform phenotypic analysis under various growth conditions
d. Analyze developmental progression using time-lapse microscopy
e. Test for sensitivity to various stressors (oxidative, genotoxic, etc.)
f. Identify protein interaction partners using immunoprecipitation
g. Perform rescue experiments with wild-type and mutant constructs
Dictyostelium discoideum presents significant advantages for toxicity-based studies involving proteins like DDB_G0284397:
Established Toxicity Testing Platform:
Comparative Data with Known Teratogens:
Researchers can leverage existing data on teratogenic compounds to contextualize DDB_G0284397 studies:
| Compound | Growth IC50 (mM) | Developmental Effect | Potential DDB_G0284397 Relevance |
|---|---|---|---|
| Lithium | 7-10 | Developmental arrest | Control for toxicity studies |
| Valproic acid | 1-2 | Aberrant stalk formation | Positive control for developmental defects |
| Caffeine | >20 | Minimal effect | Negative control for specificity |
Parallel Phenotyping Approaches:
Mechanistic Insight into Toxicity:
These approaches allow researchers to determine if DDB_G0284397 plays a role in toxicant response pathways or if its function is modulated by specific chemical exposures, potentially revealing novel functions of this uncharacterized protein .
Several bioinformatic approaches can be employed to predict the function of DDB_G0284397:
Sequence-Based Analysis:
Hidden Markov Model (HMM) profile searching against protein family databases
Position-Specific Iterated BLAST (PSI-BLAST) for distant homology detection
Multiple sequence alignment with putative orthologs from related species
Transmembrane domain prediction using TMHMM or Phobius (given hydrophobic regions)
Structural Prediction and Analysis:
AlphaFold2 structure prediction to identify potential functional domains
Molecular docking simulations with candidate ligands or binding partners
Molecular dynamics simulations to identify stable conformations
Electrostatic surface potential mapping to identify potential binding sites
Systems Biology Approaches:
Gene co-expression network analysis across developmental time points
Protein interaction network prediction using interolog mapping
Metabolic pathway association through guilt-by-association methods
Cross-species functional annotation transfer from better-characterized organisms
Integrative Data Analysis Framework:
The following analytical framework can help prioritize functional hypotheses:
| Analysis Level | Methods | Expected Outcomes | Confidence Level |
|---|---|---|---|
| Primary sequence | Motif detection, domain prediction | Partial functional hints | Low-Medium |
| Secondary structure | Alpha-helix, beta-sheet prediction | Structural class assignment | Medium |
| Tertiary structure | AlphaFold2 prediction | Potential binding pockets, active sites | Medium-High |
| Expression context | Transcriptomics, proteomics | Functional associations | Medium-High |
| Evolutionary context | Phylogenetic profiling | Conserved functional relationships | High |
By integrating these approaches, researchers can develop testable hypotheses about DDB_G0284397 function that can guide experimental design .
Genome-wide experimental approaches offer powerful strategies for elucidating the function of uncharacterized proteins like DDB_G0284397:
Genome-Wide CRISPR Screens:
Synthetic lethality screens with DDB_G0284397 knockout
Suppressor screens to identify genes that rescue DDB_G0284397 mutant phenotypes
Chemical-genetic interaction screens under various stressors
The small genome size of Dictyostelium (approximately 12,500 genes) makes genome-wide approaches particularly feasible
Transcriptomic Analysis:
RNA-seq comparing wild-type and DDB_G0284397 knockout strains
Temporal transcriptomic profiling during development
Single-cell RNA-seq to identify cell-type specific effects
Differential expression analysis under various stress conditions
Proteomics Approaches:
Proximity labeling (BioID/TurboID) to identify protein interaction neighborhood
Global proteome changes in knockout vs. wild-type
Post-translational modification analysis
Protein turnover and stability measurements
Metabolomics Integration:
Global metabolite profiling in knockout vs. wild-type
Flux analysis of key metabolic pathways
Lipidomics to identify membrane composition changes
Integration with proteomics and transcriptomics data
Phenomics Framework:
A systematic phenotypic characterization approach can be particularly informative:
| Phenotypic Level | Measurement Approaches | Potential DDB_G0284397 Insights |
|---|---|---|
| Cellular | Growth rate, cell morphology, cytoskeletal dynamics | Basic cellular functions |
| Developmental | Aggregation timing, mound formation, culmination | Role in multicellularity |
| Stress response | Survival under oxidative, osmotic, genotoxic stress | Protective functions |
| Pathogen interaction | Growth with various bacterial prey, resistance to pathogens | Immune-related functions |
| Genome stability | Mutation rate, chromosomal abnormalities | DNA maintenance role |
These genome-wide approaches, combined with the experimental tractability of Dictyostelium, provide a powerful platform for functional characterization of uncharacterized proteins like DDB_G0284397 .
Effective sharing of research materials related to DDB_G0284397 is essential for advancing our understanding of this protein. The following best practices are recommended:
Strain and Plasmid Repositories:
Recombinant Protein Distribution:
Data Sharing Standards:
Collaborative Framework:
The Dictyostelium research community has established resources that facilitate collaboration:
| Resource | URL | Purpose for DDB_G0284397 Research |
|---|---|---|
| dictyBase | http://dictybase.org | Gene information, strain ordering, community hub |
| Dicty Stock Center | http://dictybase.org/StockCenter | Repository for strains and plasmids |
| SACGB | https://sacgb.leibniz-fli.de | Comparative genomics across social amoebae |
| dictyExpress | https://dictyexpress.research.bcm.edu | Gene expression data across conditions |
By adhering to these practices, researchers can accelerate progress in understanding DDB_G0284397 function through community-wide efforts .
When facing contradictory findings about proteins like DDB_G0284397, a systematic approach to data integration can help resolve discrepancies:
Multi-level Data Triangulation:
Compare phenotypic data across different laboratories and conditions
Integrate data from various methodological approaches (genetics, biochemistry, cell biology)
Reconcile in vitro biochemical findings with in vivo functional studies
Consider strain background effects and genetic modifiers
Methodological Heterogeneity Assessment:
Evaluate differences in experimental conditions, buffers, and reagents
Compare recombinant protein tags and expression systems
Assess knockout/knockdown strategies and potential compensatory mechanisms
Consider differences in phenotypic assay sensitivities
Contextual Dependency Framework:
Apparent contradictions may reflect context-dependent functions:
| Context | Experimental Approach | Potential Function |
|---|---|---|
| Vegetative growth | Growth assays, live imaging | Cellular homeostasis |
| Development | Developmental timing, pattern formation | Multicellularity regulation |
| Stress conditions | Survival assays, stress response | Protective functions |
| Protein interactions | Different tags, pull-down conditions | Context-specific interactions |
Integrated Data Analysis Workflow:
a. Compile all available data on DDB_G0284397 with detailed metadata
b. Standardize data formats and normalization methods where possible
c. Apply machine learning approaches to identify patterns across datasets
d. Develop testable hypotheses that account for apparent contradictions
e. Design critical experiments specifically to address discrepancies
f. Consider genetic background effects and environmental influences
By systematically integrating diverse experimental approaches and carefully examining the context of seemingly contradictory results, researchers can develop a more nuanced understanding of DDB_G0284397 function across different biological contexts .
Based on current knowledge and the unique properties of Dictyostelium discoideum as a model organism, several promising research directions emerge for understanding DDB_G0284397 function:
Evolutionary Functional Analysis:
Comparative studies across social amoeba species to identify conserved functions
Investigation of potential orthologs in other eukaryotic lineages
Analysis of selection pressures acting on the gene through evolutionary time
This approach leverages Dictyostelium's position at the evolutionary crossroads between uni- and multicellular life
Developmental Role Characterization:
Stress Response Integration:
Structural Biology Pipeline:
High-resolution structure determination via X-ray crystallography or cryo-EM
Structure-guided mutagenesis to identify functional residues
Protein-protein interaction surface mapping
This direction would provide mechanistic insights into molecular function
These research directions, pursued in parallel, would provide complementary insights into DDB_G0284397 function within the broader context of Dictyostelium biology and evolution .
Investigations of DDB_G0284397 have potential to contribute to broader biological understanding in several key areas:
Evolution of Multicellularity:
If DDB_G0284397 plays a role in Dictyostelium's developmental program, findings may illuminate mechanisms underlying the transition from unicellular to multicellular life
The protein may represent specialized functions that emerged during the evolution of cellular cooperation and differentiation
Comparative analysis across Amoebozoa with different levels of sociality could reveal evolutionary innovations
Cell-Autonomous Defense Mechanisms:
Given Dictyostelium's role as a model phagocyte, DDB_G0284397 may contribute to cellular defense against pathogens
Findings could identify conserved mechanisms for cellular protection that predate the evolution of specialized immune cells
Results may translate to understanding innate immune functions in higher organisms
Genome Stability Pathways:
If DDB_G0284397 participates in DNA repair or genome maintenance, findings may reveal alternative pathways not present in higher eukaryotes
Such discoveries could explain how Dictyostelium maintains genome integrity despite lacking certain canonical repair proteins
These insights might identify novel strategies for genome protection applicable to human disease contexts
Translational Research Framework:
The following table outlines potential translational relevance:
| Research Area | DDB_G0284397 Contribution | Broader Impact |
|---|---|---|
| Cancer biology | Novel DNA repair mechanisms | Alternative therapeutic targets |
| Developmental disorders | Insights into cell differentiation | Models for developmental defects |
| Microbial pathogenesis | Host-pathogen interaction mechanisms | New anti-infective strategies |
| Environmental toxicology | Cellular response to toxicants | Novel biomarkers for exposure |